BLASTX nr result
ID: Angelica27_contig00013439
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00013439 (201 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017229746.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 99 1e-22 >XP_017229746.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Daucus carota subsp. sativus] KZN09464.1 hypothetical protein DCAR_002120 [Daucus carota subsp. sativus] Length = 535 Score = 98.6 bits (244), Expect = 1e-22 Identities = 49/67 (73%), Positives = 58/67 (86%) Frame = +1 Query: 1 FDAEFSFEVPLSNGLYSSRSSEICKNVESKNVKKVDGVSGGKLKENGHVKSSVHCSPVSN 180 FDAEFS ++PLSNG+ SS+ SEICKN+ESK+VKKV GV GG+LKENGH+ SSV C PVSN Sbjct: 49 FDAEFSVKLPLSNGVASSKPSEICKNIESKDVKKV-GVLGGRLKENGHINSSVGCLPVSN 107 Query: 181 GSVEQES 201 GSVE +S Sbjct: 108 GSVELDS 114