BLASTX nr result
ID: Angelica27_contig00013428
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00013428 (251 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017218340.1 PREDICTED: 1,4-dihydroxy-2-naphthoyl-CoA thioeste... 60 2e-09 XP_017218339.1 PREDICTED: 1,4-dihydroxy-2-naphthoyl-CoA thioeste... 58 2e-08 >XP_017218340.1 PREDICTED: 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1-like [Daucus carota subsp. sativus] Length = 159 Score = 60.1 bits (144), Expect = 2e-09 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 156 MELTSPTNKTQELDAPLHAIGFEIHELSPEKV 251 MELTS TNKTQELDAPLH IGFEI ELSPEKV Sbjct: 1 MELTSSTNKTQELDAPLHTIGFEIDELSPEKV 32 >XP_017218339.1 PREDICTED: 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1-like [Daucus carota subsp. sativus] Length = 159 Score = 57.8 bits (138), Expect = 2e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 156 MELTSPTNKTQELDAPLHAIGFEIHELSPEKV 251 MELTS TNKTQELDAPL+ IGFEI ELSPEKV Sbjct: 1 MELTSSTNKTQELDAPLYTIGFEIDELSPEKV 32