BLASTX nr result
ID: Angelica27_contig00013394
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00013394 (1120 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017238809.1 PREDICTED: uncharacterized protein LOC108211664 [... 298 2e-97 XP_009334915.1 PREDICTED: probable E3 ubiquitin-protein ligase L... 89 4e-18 NP_001327480.1 RING/U-box superfamily protein [Arabidopsis thali... 91 9e-18 XP_002883568.1 hypothetical protein ARALYDRAFT_480010 [Arabidops... 91 2e-17 OAP06731.1 hypothetical protein AXX17_AT3G27030 [Arabidopsis tha... 91 2e-17 NP_189139.1 RING/U-box superfamily protein [Arabidopsis thaliana... 91 2e-17 XP_006298377.1 hypothetical protein CARUB_v10014448mg [Capsella ... 91 2e-17 JAU12015.1 hypothetical protein GA_TR11180_c0_g1_i1_g.36109 [Noc... 91 2e-17 JAV00740.1 hypothetical protein MP_TR13555_c0_g1_i1_g.39655 [Noc... 91 2e-17 JAU67295.1 hypothetical protein LE_TR20014_c0_g1_i1_g.64026 [Noc... 91 2e-17 JAU43102.1 hypothetical protein LC_TR2899_c0_g1_i1_g.11559 [Nocc... 91 2e-17 XP_019096252.1 PREDICTED: LON peptidase N-terminal domain and RI... 91 3e-17 XP_010488610.1 PREDICTED: uncharacterized protein LOC104766417 i... 91 3e-17 XP_010513807.1 PREDICTED: LON peptidase N-terminal domain and RI... 91 3e-17 XP_006284342.1 hypothetical protein CARUB_v10005514mg [Capsella ... 91 3e-17 XP_019092091.1 PREDICTED: LON peptidase N-terminal domain and RI... 91 3e-17 OAP00233.1 hypothetical protein AXX17_AT4G14780 [Arabidopsis tha... 91 3e-17 NP_001078383.1 RING/U-box superfamily protein [Arabidopsis thali... 91 3e-17 NP_001190713.1 RING/U-box superfamily protein [Arabidopsis thali... 91 3e-17 NP_193046.2 RING/U-box superfamily protein [Arabidopsis thaliana... 91 3e-17 >XP_017238809.1 PREDICTED: uncharacterized protein LOC108211664 [Daucus carota subsp. sativus] KZN03897.1 hypothetical protein DCAR_012653 [Daucus carota subsp. sativus] Length = 247 Score = 298 bits (764), Expect = 2e-97 Identities = 158/247 (63%), Positives = 170/247 (68%), Gaps = 1/247 (0%) Frame = +1 Query: 316 MENIGGPSNHLGELLRLRQEEDSGDDNGRNFISGQTLASVINADKTDYPTLLDVLRQDSS 495 M N GGPSNHLGELLRLRQEEDSGDD+ RN ISGQTL SVI+ADKTD+PTLLDVL+Q+S Sbjct: 1 MGNRGGPSNHLGELLRLRQEEDSGDDHRRNSISGQTLGSVIDADKTDFPTLLDVLQQESG 60 Query: 496 GNSKKKWKGFKEKLRLRRGGAAWCSASRMLISDVVMNNTILSNRMIMGRGEMPENLSRIG 675 GNS+KKWKGF+EKLRLRRGGAAWCSASRMLISDV +NNTIL++RMIMGRG MPENLS G Sbjct: 61 GNSRKKWKGFREKLRLRRGGAAWCSASRMLISDVAINNTILTSRMIMGRGGMPENLSGTG 120 Query: 676 RNNEMVLPENDXXXXXXXXXXXXXXXXXXPARXXXXXXXXXXXXXGFETEFI-IXXXXXX 852 RN + LPEND PAR GFET FI Sbjct: 121 RNIDTRLPENDVTPEVTAATVPEDGGEEGPARLSLMALLETEMEIGFETSFIPNDDVTEE 180 Query: 853 XXXXXXXXXXXXXXXXXXXXXXXXRNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKI 1032 R+KGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKI Sbjct: 181 DEDVEGGVGGAGEVHGGGCCVCMVRDKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKI 240 Query: 1033 LEILDIF 1053 LEILDIF Sbjct: 241 LEILDIF 247 >XP_009334915.1 PREDICTED: probable E3 ubiquitin-protein ligase LUL4 [Pyrus x bretschneideri] Length = 101 Score = 88.6 bits (218), Expect = 4e-18 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCR+CSRELWV+RGNCPLCN ILEILDIF Sbjct: 59 RHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNNFILEILDIF 101 >NP_001327480.1 RING/U-box superfamily protein [Arabidopsis thaliana] ANM65520.1 RING/U-box superfamily protein [Arabidopsis thaliana] Length = 210 Score = 90.9 bits (224), Expect = 9e-18 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT ILE+LD+F Sbjct: 168 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF 210 >XP_002883568.1 hypothetical protein ARALYDRAFT_480010 [Arabidopsis lyrata subsp. lyrata] EFH59827.1 hypothetical protein ARALYDRAFT_480010 [Arabidopsis lyrata subsp. lyrata] Length = 247 Score = 90.9 bits (224), Expect = 2e-17 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT ILE+LD+F Sbjct: 205 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF 247 >OAP06731.1 hypothetical protein AXX17_AT3G27030 [Arabidopsis thaliana] Length = 249 Score = 90.9 bits (224), Expect = 2e-17 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT ILE+LD+F Sbjct: 207 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF 249 >NP_189139.1 RING/U-box superfamily protein [Arabidopsis thaliana] NP_001030762.1 RING/U-box superfamily protein [Arabidopsis thaliana] NP_001327479.1 RING/U-box superfamily protein [Arabidopsis thaliana] BAB01888.1 unnamed protein product [Arabidopsis thaliana] AAT47796.1 At3g25030 [Arabidopsis thaliana] AAU05520.1 At3g25030 [Arabidopsis thaliana] AEE76969.1 RING/U-box superfamily protein [Arabidopsis thaliana] AEE76970.1 RING/U-box superfamily protein [Arabidopsis thaliana] ANM65519.1 RING/U-box superfamily protein [Arabidopsis thaliana] Length = 250 Score = 90.9 bits (224), Expect = 2e-17 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT ILE+LD+F Sbjct: 208 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF 250 >XP_006298377.1 hypothetical protein CARUB_v10014448mg [Capsella rubella] XP_006298378.1 hypothetical protein CARUB_v10014448mg [Capsella rubella] EOA31275.1 hypothetical protein CARUB_v10014448mg [Capsella rubella] EOA31276.1 hypothetical protein CARUB_v10014448mg [Capsella rubella] Length = 256 Score = 90.9 bits (224), Expect = 2e-17 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT ILE+LD+F Sbjct: 214 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF 256 >JAU12015.1 hypothetical protein GA_TR11180_c0_g1_i1_g.36109 [Noccaea caerulescens] Length = 275 Score = 91.3 bits (225), Expect = 2e-17 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT ILEILD+F Sbjct: 233 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTAILEILDLF 275 >JAV00740.1 hypothetical protein MP_TR13555_c0_g1_i1_g.39655 [Noccaea caerulescens] Length = 279 Score = 91.3 bits (225), Expect = 2e-17 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT ILEILD+F Sbjct: 237 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEILDLF 279 >JAU67295.1 hypothetical protein LE_TR20014_c0_g1_i1_g.64026 [Noccaea caerulescens] Length = 279 Score = 91.3 bits (225), Expect = 2e-17 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT ILEILD+F Sbjct: 237 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEILDLF 279 >JAU43102.1 hypothetical protein LC_TR2899_c0_g1_i1_g.11559 [Noccaea caerulescens] Length = 279 Score = 91.3 bits (225), Expect = 2e-17 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT ILEILD+F Sbjct: 237 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTAILEILDLF 279 >XP_019096252.1 PREDICTED: LON peptidase N-terminal domain and RING finger protein 3-like isoform X1 [Camelina sativa] XP_019096253.1 PREDICTED: LON peptidase N-terminal domain and RING finger protein 3-like isoform X1 [Camelina sativa] Length = 263 Score = 90.9 bits (224), Expect = 3e-17 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT ILE+LD+F Sbjct: 221 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF 263 >XP_010488610.1 PREDICTED: uncharacterized protein LOC104766417 isoform X2 [Camelina sativa] Length = 263 Score = 90.9 bits (224), Expect = 3e-17 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT ILE+LD+F Sbjct: 221 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF 263 >XP_010513807.1 PREDICTED: LON peptidase N-terminal domain and RING finger protein 1-like [Camelina sativa] XP_010513808.1 PREDICTED: LON peptidase N-terminal domain and RING finger protein 1-like [Camelina sativa] XP_019083534.1 PREDICTED: LON peptidase N-terminal domain and RING finger protein 1-like [Camelina sativa] Length = 265 Score = 90.9 bits (224), Expect = 3e-17 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT ILE+LD+F Sbjct: 223 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF 265 >XP_006284342.1 hypothetical protein CARUB_v10005514mg [Capsella rubella] EOA17240.1 hypothetical protein CARUB_v10005514mg [Capsella rubella] Length = 248 Score = 90.5 bits (223), Expect = 3e-17 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT IL++LDIF Sbjct: 206 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILQVLDIF 248 >XP_019092091.1 PREDICTED: LON peptidase N-terminal domain and RING finger protein 3 [Camelina sativa] Length = 267 Score = 90.9 bits (224), Expect = 3e-17 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT ILE+LD+F Sbjct: 225 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF 267 >OAP00233.1 hypothetical protein AXX17_AT4G14780 [Arabidopsis thaliana] Length = 256 Score = 90.5 bits (223), Expect = 3e-17 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT IL++LDIF Sbjct: 214 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTAILQVLDIF 256 >NP_001078383.1 RING/U-box superfamily protein [Arabidopsis thaliana] NP_001190714.1 RING/U-box superfamily protein [Arabidopsis thaliana] AEE83233.1 RING/U-box superfamily protein [Arabidopsis thaliana] AEE83235.1 RING/U-box superfamily protein [Arabidopsis thaliana] Length = 256 Score = 90.5 bits (223), Expect = 3e-17 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT IL++LDIF Sbjct: 214 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTAILQVLDIF 256 >NP_001190713.1 RING/U-box superfamily protein [Arabidopsis thaliana] AEE83234.1 RING/U-box superfamily protein [Arabidopsis thaliana] Length = 256 Score = 90.5 bits (223), Expect = 3e-17 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT IL++LDIF Sbjct: 214 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTAILQVLDIF 256 >NP_193046.2 RING/U-box superfamily protein [Arabidopsis thaliana] NP_001329823.1 RING/U-box superfamily protein [Arabidopsis thaliana] NP_001329822.1 RING/U-box superfamily protein [Arabidopsis thaliana] NP_001329824.1 RING/U-box superfamily protein [Arabidopsis thaliana] AEE83231.1 RING/U-box superfamily protein [Arabidopsis thaliana] ANM68040.1 RING/U-box superfamily protein [Arabidopsis thaliana] ANM68041.1 RING/U-box superfamily protein [Arabidopsis thaliana] ANM68042.1 RING/U-box superfamily protein [Arabidopsis thaliana] Length = 259 Score = 90.5 bits (223), Expect = 3e-17 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 925 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 1053 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT IL++LDIF Sbjct: 217 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTAILQVLDIF 259