BLASTX nr result
ID: Angelica27_contig00013380
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00013380 (267 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017243694.1 PREDICTED: uncharacterized protein At1g04910-like... 107 3e-25 >XP_017243694.1 PREDICTED: uncharacterized protein At1g04910-like [Daucus carota subsp. sativus] KZM98726.1 hypothetical protein DCAR_013912 [Daucus carota subsp. sativus] Length = 576 Score = 107 bits (267), Expect = 3e-25 Identities = 51/57 (89%), Positives = 53/57 (92%), Gaps = 1/57 (1%) Frame = +1 Query: 100 HNRHLHRSLIDT-GDADARKLLPFRVPDYVNVSSRNIWRSEMSEFYYGCSTASDKFA 267 HNRHLHRSLIDT GD DARKL+ FRVPDYVNVS RNIWRS+MSEFYYGCSTASDKFA Sbjct: 45 HNRHLHRSLIDTRGDVDARKLVEFRVPDYVNVSGRNIWRSKMSEFYYGCSTASDKFA 101