BLASTX nr result
ID: Angelica27_contig00013325
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00013325 (534 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO86982.1 hypothetical protein CISIN_1g023982mg [Citrus sinensis] 67 4e-10 XP_006444507.1 hypothetical protein CICLE_v10021624mg [Citrus cl... 67 4e-10 KZM95052.1 hypothetical protein DCAR_018294 [Daucus carota subsp... 65 8e-10 XP_017250159.1 PREDICTED: probable WRKY transcription factor 65 ... 65 1e-09 XP_017237662.1 PREDICTED: probable WRKY transcription factor 69 ... 65 1e-09 GAV83623.1 WRKY domain-containing protein [Cephalotus follicularis] 64 6e-09 AFX83949.1 WRKY super family protein [Hevea brasiliensis] 63 8e-09 XP_006840437.1 PREDICTED: probable WRKY transcription factor 65 ... 64 9e-09 AEQ29017.1 WRKY4 [Panax quinquefolius] 63 9e-09 XP_018822132.1 PREDICTED: probable WRKY transcription factor 69 ... 62 1e-08 XP_019428628.1 PREDICTED: probable WRKY transcription factor 65 ... 63 1e-08 XP_017636978.1 PREDICTED: probable WRKY transcription factor 65 ... 62 1e-08 XP_002270750.3 PREDICTED: probable WRKY transcription factor 65 ... 62 1e-08 ABS18437.1 transcription factor, partial [Glycine max] 61 2e-08 XP_018822131.1 PREDICTED: probable WRKY transcription factor 69 ... 62 2e-08 XP_017969931.1 PREDICTED: WRKY transcription factor 22 [Theobrom... 62 2e-08 EOX95271.1 WRKY DNA-binding protein 35, putative [Theobroma cacao] 62 2e-08 XP_006492342.1 PREDICTED: probable WRKY transcription factor 65 ... 62 2e-08 XP_006444508.1 hypothetical protein CICLE_v10021624mg [Citrus cl... 62 2e-08 XP_016205747.1 PREDICTED: probable WRKY transcription factor 65 ... 62 2e-08 >KDO86982.1 hypothetical protein CISIN_1g023982mg [Citrus sinensis] Length = 248 Score = 66.6 bits (161), Expect = 4e-10 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -2 Query: 122 D*MFWHLIL-CRGYYRCSTSKGCLAKKQVERCRTDASLLII 3 D + W L L CRGYYRCSTSKGC AKKQVERCRTDAS+LII Sbjct: 39 DVLKWILPLNCRGYYRCSTSKGCSAKKQVERCRTDASMLII 79 >XP_006444507.1 hypothetical protein CICLE_v10021624mg [Citrus clementina] ESR57747.1 hypothetical protein CICLE_v10021624mg [Citrus clementina] Length = 248 Score = 66.6 bits (161), Expect = 4e-10 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -2 Query: 122 D*MFWHLIL-CRGYYRCSTSKGCLAKKQVERCRTDASLLII 3 D + W L L CRGYYRCSTSKGC AKKQVERCRTDAS+LII Sbjct: 39 DVLKWILPLNCRGYYRCSTSKGCSAKKQVERCRTDASMLII 79 >KZM95052.1 hypothetical protein DCAR_018294 [Daucus carota subsp. sativus] Length = 218 Score = 65.5 bits (158), Expect = 8e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCSTSKGCLAKKQVERCRTDASLLII Sbjct: 46 RGYYRCSTSKGCLAKKQVERCRTDASLLII 75 >XP_017250159.1 PREDICTED: probable WRKY transcription factor 65 [Daucus carota subsp. sativus] Length = 247 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCSTSKGCLAKKQVERCRTDASLLII Sbjct: 75 RGYYRCSTSKGCLAKKQVERCRTDASLLII 104 >XP_017237662.1 PREDICTED: probable WRKY transcription factor 69 [Daucus carota subsp. sativus] KZN03581.1 hypothetical protein DCAR_012337 [Daucus carota subsp. sativus] Length = 260 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCSTSKGCLAKKQVERCRTDASLLII Sbjct: 73 RGYYRCSTSKGCLAKKQVERCRTDASLLII 102 >GAV83623.1 WRKY domain-containing protein [Cephalotus follicularis] Length = 261 Score = 63.5 bits (153), Expect = 6e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCST+KGCLAKKQVERCRTDAS+LII Sbjct: 72 RGYYRCSTTKGCLAKKQVERCRTDASMLII 101 >AFX83949.1 WRKY super family protein [Hevea brasiliensis] Length = 259 Score = 63.2 bits (152), Expect = 8e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCSTSKGC AKKQVERCRTDASLLII Sbjct: 73 RGYYRCSTSKGCSAKKQVERCRTDASLLII 102 >XP_006840437.1 PREDICTED: probable WRKY transcription factor 65 [Amborella trichopoda] ERN02112.1 hypothetical protein AMTR_s00045p00165950 [Amborella trichopoda] Length = 306 Score = 63.5 bits (153), Expect = 9e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCST+KGCLAKKQVERCRTDAS+LII Sbjct: 141 RGYYRCSTAKGCLAKKQVERCRTDASMLII 170 >AEQ29017.1 WRKY4 [Panax quinquefolius] Length = 271 Score = 63.2 bits (152), Expect = 9e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCSTSKGC AKKQVERCRTDASLLII Sbjct: 75 RGYYRCSTSKGCSAKKQVERCRTDASLLII 104 >XP_018822132.1 PREDICTED: probable WRKY transcription factor 69 isoform X2 [Juglans regia] Length = 231 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCSTSKGC AKKQVERCRTDAS+LII Sbjct: 45 RGYYRCSTSKGCSAKKQVERCRTDASMLII 74 >XP_019428628.1 PREDICTED: probable WRKY transcription factor 65 [Lupinus angustifolius] OIV91012.1 hypothetical protein TanjilG_16972 [Lupinus angustifolius] Length = 265 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCST KGCLAKKQVERCRTDAS+LII Sbjct: 73 RGYYRCSTCKGCLAKKQVERCRTDASMLII 102 >XP_017636978.1 PREDICTED: probable WRKY transcription factor 65 [Gossypium arboreum] Length = 240 Score = 62.4 bits (150), Expect = 1e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYY+CSTSKGCLAKKQVERC+TDAS+LII Sbjct: 64 RGYYKCSTSKGCLAKKQVERCKTDASMLII 93 >XP_002270750.3 PREDICTED: probable WRKY transcription factor 65 [Vitis vinifera] CBI36956.3 unnamed protein product, partial [Vitis vinifera] Length = 242 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCSTSKGC AKKQVERCRTDAS+LII Sbjct: 67 RGYYRCSTSKGCSAKKQVERCRTDASMLII 96 >ABS18437.1 transcription factor, partial [Glycine max] Length = 179 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYY+CSTSKGC AKKQVERCRTDAS+LII Sbjct: 78 RGYYKCSTSKGCSAKKQVERCRTDASMLII 107 >XP_018822131.1 PREDICTED: probable WRKY transcription factor 69 isoform X1 [Juglans regia] Length = 259 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCSTSKGC AKKQVERCRTDAS+LII Sbjct: 73 RGYYRCSTSKGCSAKKQVERCRTDASMLII 102 >XP_017969931.1 PREDICTED: WRKY transcription factor 22 [Theobroma cacao] Length = 269 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCSTSKGC AKKQVERCRTDAS+LII Sbjct: 78 RGYYRCSTSKGCSAKKQVERCRTDASMLII 107 >EOX95271.1 WRKY DNA-binding protein 35, putative [Theobroma cacao] Length = 269 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCSTSKGC AKKQVERCRTDAS+LII Sbjct: 78 RGYYRCSTSKGCSAKKQVERCRTDASMLII 107 >XP_006492342.1 PREDICTED: probable WRKY transcription factor 65 [Citrus sinensis] KDO86981.1 hypothetical protein CISIN_1g023982mg [Citrus sinensis] Length = 274 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCSTSKGC AKKQVERCRTDAS+LII Sbjct: 76 RGYYRCSTSKGCSAKKQVERCRTDASMLII 105 >XP_006444508.1 hypothetical protein CICLE_v10021624mg [Citrus clementina] ESR57748.1 hypothetical protein CICLE_v10021624mg [Citrus clementina] Length = 274 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCSTSKGC AKKQVERCRTDAS+LII Sbjct: 76 RGYYRCSTSKGCSAKKQVERCRTDASMLII 105 >XP_016205747.1 PREDICTED: probable WRKY transcription factor 65 [Arachis ipaensis] Length = 278 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 92 RGYYRCSTSKGCLAKKQVERCRTDASLLII 3 RGYYRCSTSKGC AKKQVERCRTDAS+LII Sbjct: 77 RGYYRCSTSKGCSAKKQVERCRTDASMLII 106