BLASTX nr result
ID: Angelica27_contig00013295
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00013295 (187 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017234174.1 PREDICTED: basic leucine zipper 43-like [Daucus c... 70 2e-13 XP_017225769.1 PREDICTED: basic leucine zipper 43-like [Daucus c... 56 6e-08 >XP_017234174.1 PREDICTED: basic leucine zipper 43-like [Daucus carota subsp. sativus] KZN06373.1 hypothetical protein DCAR_007210 [Daucus carota subsp. sativus] Length = 199 Score = 70.1 bits (170), Expect = 2e-13 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = -2 Query: 126 MMFPSEFVGIQTFAQETPSYFENNCGNMQSSMSSLHHFDNLL 1 MMFPSEF GIQT AQ+TPS+FENNCG +QS MS+L++F+NLL Sbjct: 1 MMFPSEFAGIQTLAQDTPSHFENNCGIIQSDMSTLNYFNNLL 42 >XP_017225769.1 PREDICTED: basic leucine zipper 43-like [Daucus carota subsp. sativus] KZM82499.1 hypothetical protein DCAR_030068 [Daucus carota subsp. sativus] Length = 192 Score = 55.8 bits (133), Expect = 6e-08 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -2 Query: 126 MMFPSEFVGIQTFAQETPSYFENNCGNMQSSMSSLHHFDNLL 1 MMFPSEF+G QT AQE S+ +NNC +QS+MS L FDN L Sbjct: 1 MMFPSEFLGTQTLAQECISHVDNNCSVIQSNMSPLQDFDNFL 42