BLASTX nr result
ID: Angelica27_contig00012465
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00012465 (712 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017258739.1 PREDICTED: probable serine/threonine-protein kina... 78 7e-13 >XP_017258739.1 PREDICTED: probable serine/threonine-protein kinase WNK10 isoform X1 [Daucus carota subsp. sativus] KZM90508.1 hypothetical protein DCAR_022127 [Daucus carota subsp. sativus] Length = 670 Score = 77.8 bits (190), Expect = 7e-13 Identities = 39/51 (76%), Positives = 41/51 (80%), Gaps = 6/51 (11%) Frame = -1 Query: 136 MNSGSQN------VNKDALIGNADPQLDYVEMDPKARYVRYNEILGKGAFK 2 MNSGSQ+ V KD LIGN DPQ+DYVEMDPK RYVRYNEILGKGAFK Sbjct: 1 MNSGSQSGGSMLSVYKDGLIGNVDPQVDYVEMDPKGRYVRYNEILGKGAFK 51