BLASTX nr result
ID: Angelica27_contig00012433
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00012433 (508 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN07621.1 hypothetical protein DCAR_008458 [Daucus carota subsp... 74 7e-14 XP_017234302.1 PREDICTED: 21 kDa protein-like [Daucus carota sub... 74 2e-13 >KZN07621.1 hypothetical protein DCAR_008458 [Daucus carota subsp. sativus] Length = 147 Score = 74.3 bits (181), Expect = 7e-14 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +3 Query: 3 TCMDGFYNVNEGNVKAKVSKYAVNVSQLTSIALTFINRYADS 128 TCMDGFYNVNEG VKAK KYA+NVSQLTSI+L FINRYA+S Sbjct: 102 TCMDGFYNVNEGYVKAKARKYAMNVSQLTSISLAFINRYANS 143 >XP_017234302.1 PREDICTED: 21 kDa protein-like [Daucus carota subsp. sativus] Length = 206 Score = 74.3 bits (181), Expect = 2e-13 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +3 Query: 3 TCMDGFYNVNEGNVKAKVSKYAVNVSQLTSIALTFINRYADS 128 TCMDGFYNVNEG VKAK KYA+NVSQLTSI+L FINRYA+S Sbjct: 161 TCMDGFYNVNEGYVKAKARKYAMNVSQLTSISLAFINRYANS 202