BLASTX nr result
ID: Angelica27_contig00012241
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00012241 (305 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017254302.1 PREDICTED: rho GTPase-activating protein 5-like [... 56 6e-07 >XP_017254302.1 PREDICTED: rho GTPase-activating protein 5-like [Daucus carota subsp. sativus] KZM91896.1 hypothetical protein DCAR_020739 [Daucus carota subsp. sativus] Length = 492 Score = 55.8 bits (133), Expect = 6e-07 Identities = 28/33 (84%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = -2 Query: 97 DNDVFHQQTSSFIDT-SPVDLYRVEEEESIFRE 2 DNDVFHQQTSSFI T SPVDL+R EEEE IFRE Sbjct: 24 DNDVFHQQTSSFIHTTSPVDLHRAEEEEGIFRE 56