BLASTX nr result
ID: Angelica27_contig00012225
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00012225 (386 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017259084.1 PREDICTED: uncharacterized protein LOC108228108 [... 55 3e-06 KZN12123.1 hypothetical protein DCAR_004779 [Daucus carota subsp... 55 3e-06 >XP_017259084.1 PREDICTED: uncharacterized protein LOC108228108 [Daucus carota subsp. sativus] Length = 844 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -1 Query: 368 LIEPLCKLLLEGDMSVSDVKLEAAWAIFNGIYGGNFRQIDEYPG 237 LIEPL LL E D+ SDVK+EAAWAIFNGI G ++ QID Y G Sbjct: 797 LIEPLYDLL-ENDVYESDVKMEAAWAIFNGICGNDYGQIDHYYG 839 >KZN12123.1 hypothetical protein DCAR_004779 [Daucus carota subsp. sativus] Length = 874 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -1 Query: 368 LIEPLCKLLLEGDMSVSDVKLEAAWAIFNGIYGGNFRQIDEYPG 237 LIEPL LL E D+ SDVK+EAAWAIFNGI G ++ QID Y G Sbjct: 827 LIEPLYDLL-ENDVYESDVKMEAAWAIFNGICGNDYGQIDHYYG 869