BLASTX nr result
ID: Angelica27_contig00012152
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00012152 (393 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017230053.1 PREDICTED: RING finger and transmembrane domain-c... 116 3e-28 >XP_017230053.1 PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Daucus carota subsp. sativus] XP_017230054.1 PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Daucus carota subsp. sativus] KZN12130.1 hypothetical protein DCAR_004786 [Daucus carota subsp. sativus] Length = 460 Score = 116 bits (291), Expect = 3e-28 Identities = 58/85 (68%), Positives = 67/85 (78%) Frame = -1 Query: 384 SSSNPVRLRYNLSASNLIHTPLLTLLDYFGLLHNSPISPRATASNQEMQALLRNPPPHFH 205 +SSNPVRLRYNLSASNLIHTPLLTLLDYFGLLHN PISPR SNQ+MQALLRNPPPHFH Sbjct: 19 TSSNPVRLRYNLSASNLIHTPLLTLLDYFGLLHNPPISPR--DSNQDMQALLRNPPPHFH 76 Query: 204 DTASAPSXXXGKRDIIV*LQCTIEE 130 ++PS ++ + + + EE Sbjct: 77 HLDASPSAATSSEEVSIRIIASSEE 101