BLASTX nr result
ID: Angelica27_contig00012105
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00012105 (1102 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM98979.1 hypothetical protein DCAR_013659 [Daucus carota subsp... 62 8e-09 >KZM98979.1 hypothetical protein DCAR_013659 [Daucus carota subsp. sativus] Length = 91 Score = 62.4 bits (150), Expect = 8e-09 Identities = 26/64 (40%), Positives = 37/64 (57%) Frame = -2 Query: 468 IFVAETEGGKITCISLVGPCSPEKCDIDRCNQICNNNYSNLHPSGSCQRLLNFPTLICVC 289 I V E I C+S + C + CD+ C +C N+Y +LHP G+C+ + N P +ICVC Sbjct: 27 ITVTTEEKRPIKCVSYIALCDKD-CDLSCCKSMCENDYYSLHPVGTCEHIPNNPDVICVC 85 Query: 288 IHAC 277 H C Sbjct: 86 THDC 89