BLASTX nr result
ID: Angelica27_contig00012066
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00012066 (399 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017223653.1 PREDICTED: uncharacterized protein LOC108200100 [... 48 7e-11 BAC65222.1 hypothetical protein [Daucus carota] 48 7e-11 KZM84036.1 hypothetical protein DCAR_028542 [Daucus carota subsp... 48 4e-06 >XP_017223653.1 PREDICTED: uncharacterized protein LOC108200100 [Daucus carota subsp. sativus] XP_017223654.1 PREDICTED: uncharacterized protein LOC108200100 [Daucus carota subsp. sativus] Length = 374 Score = 48.1 bits (113), Expect(2) = 7e-11 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 224 SKLGASISVNKKRKPLWDLTNFANPNTRSSN 132 SKLGAS S+ KKRKPL DLTN ANPN SSN Sbjct: 15 SKLGASSSLKKKRKPLSDLTNSANPNPNSSN 45 Score = 45.8 bits (107), Expect(2) = 7e-11 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = -3 Query: 124 KNPNNFNYKSLNSPLNLVTVSDSSIGSSNFNATVPG 17 K P+NF K L+ LN +SDSSIGSSNFN VPG Sbjct: 48 KKPSNFRSKLLSPALNCSNLSDSSIGSSNFNTPVPG 83 >BAC65222.1 hypothetical protein [Daucus carota] Length = 374 Score = 48.1 bits (113), Expect(2) = 7e-11 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 224 SKLGASISVNKKRKPLWDLTNFANPNTRSSN 132 SKLGAS S+ KKRKPL DLTN ANPN SSN Sbjct: 15 SKLGASSSLKKKRKPLSDLTNSANPNPNSSN 45 Score = 45.8 bits (107), Expect(2) = 7e-11 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = -3 Query: 124 KNPNNFNYKSLNSPLNLVTVSDSSIGSSNFNATVPG 17 K P+NF K L+ LN +SDSSIGSSNFN VPG Sbjct: 48 KKPSNFRSKLLSPALNCSNLSDSSIGSSNFNTPVPG 83 >KZM84036.1 hypothetical protein DCAR_028542 [Daucus carota subsp. sativus] Length = 364 Score = 48.1 bits (113), Expect(2) = 4e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 224 SKLGASISVNKKRKPLWDLTNFANPNTRSSN 132 SKLGAS S+ KKRKPL DLTN ANPN SSN Sbjct: 15 SKLGASSSLKKKRKPLSDLTNSANPNPNSSN 45 Score = 29.6 bits (65), Expect(2) = 4e-06 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -3 Query: 124 KNPNNFNYKSLNSPLNLVTVSDSSIG 47 K P+NF K L+ LN +SDSSIG Sbjct: 48 KKPSNFRSKLLSPALNCSNLSDSSIG 73