BLASTX nr result
ID: Angelica27_contig00011945
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00011945 (225 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017222803.1 PREDICTED: non-functional NADPH-dependent codeino... 78 2e-15 XP_017220713.1 PREDICTED: non-functional NADPH-dependent codeino... 78 2e-15 XP_017222804.1 PREDICTED: non-functional NADPH-dependent codeino... 77 3e-15 XP_017222798.1 PREDICTED: non-functional NADPH-dependent codeino... 77 3e-15 XP_017222805.1 PREDICTED: non-functional NADPH-dependent codeino... 75 3e-14 XP_017222806.1 PREDICTED: non-functional NADPH-dependent codeino... 73 1e-13 XP_017247823.1 PREDICTED: uncharacterized protein LOC108219077 i... 53 6e-07 XP_017247822.1 PREDICTED: uncharacterized protein LOC108219077 i... 53 6e-07 XP_017221805.1 PREDICTED: non-functional NADPH-dependent codeino... 54 8e-07 XP_017247821.1 PREDICTED: uncharacterized protein LOC108219077 i... 53 1e-06 XP_017222800.1 PREDICTED: non-functional NADPH-dependent codeino... 54 1e-06 XP_017222616.1 PREDICTED: non-functional NADPH-dependent codeino... 53 3e-06 XP_017216171.1 PREDICTED: non-functional NADPH-dependent codeino... 53 3e-06 XP_017222615.1 PREDICTED: non-functional NADPH-dependent codeino... 52 5e-06 XP_017222613.1 PREDICTED: non-functional NADPH-dependent codeino... 52 5e-06 XP_017222799.1 PREDICTED: non-functional NADPH-dependent codeino... 52 7e-06 XP_017222612.1 PREDICTED: non-functional NADPH-dependent codeino... 51 1e-05 >XP_017222803.1 PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Daucus carota subsp. sativus] Length = 322 Score = 78.2 bits (191), Expect = 2e-15 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 80 MAIPEISLSSRNAKAMPVLGLGIGATDPTPEVITSTINAVLEAIELGY 223 MAIPEI LSS NAK MPVLGLG+GA+DPTPEVIT+T AVL+AIELGY Sbjct: 1 MAIPEICLSSGNAKPMPVLGLGLGASDPTPEVITNTKKAVLDAIELGY 48 >XP_017220713.1 PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Daucus carota subsp. sativus] Length = 322 Score = 78.2 bits (191), Expect = 2e-15 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 80 MAIPEISLSSRNAKAMPVLGLGIGATDPTPEVITSTINAVLEAIELGY 223 MAIPEI LSS NAK MPVLGLG+GA+DPTPEVIT+T AVL+AIELGY Sbjct: 1 MAIPEICLSSGNAKPMPVLGLGLGASDPTPEVITNTKKAVLDAIELGY 48 >XP_017222804.1 PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Daucus carota subsp. sativus] Length = 322 Score = 77.4 bits (189), Expect = 3e-15 Identities = 39/48 (81%), Positives = 41/48 (85%) Frame = +2 Query: 80 MAIPEISLSSRNAKAMPVLGLGIGATDPTPEVITSTINAVLEAIELGY 223 MAIPEI LSS NAKAMPVLGLG+G DPTPE +TS I AVLEAIELGY Sbjct: 1 MAIPEIILSSGNAKAMPVLGLGLGTLDPTPEFLTSMIKAVLEAIELGY 48 >XP_017222798.1 PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Daucus carota subsp. sativus] Length = 323 Score = 77.4 bits (189), Expect = 3e-15 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = +2 Query: 80 MAIPEISLSSRNAKAMPVLGLGIGATDPTPEVITSTINAVLEAIELGY 223 MAIPEI LSS NAK MPVLGLG+GA DPTPE+IT+T AVL+AIELGY Sbjct: 2 MAIPEICLSSGNAKPMPVLGLGLGAADPTPEIITNTKKAVLDAIELGY 49 >XP_017222805.1 PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Daucus carota subsp. sativus] Length = 322 Score = 74.7 bits (182), Expect = 3e-14 Identities = 38/48 (79%), Positives = 40/48 (83%) Frame = +2 Query: 80 MAIPEISLSSRNAKAMPVLGLGIGATDPTPEVITSTINAVLEAIELGY 223 MAIPEI LSS NAKAMPVLG G+G DPTPE +TS I AVLEAIELGY Sbjct: 1 MAIPEIILSSGNAKAMPVLGPGLGTLDPTPEFLTSMIKAVLEAIELGY 48 >XP_017222806.1 PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Daucus carota subsp. sativus] Length = 319 Score = 73.2 bits (178), Expect = 1e-13 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = +2 Query: 80 MAIPEISLSSRNAKAMPVLGLGIGATDPTPEVITSTINAVLEAIELGY 223 MAIPEI LSS NAK MPVLGLG+GA DPTPE+IT NAVL+AIELGY Sbjct: 1 MAIPEICLSSGNAKPMPVLGLGLGAVDPTPEIIT---NAVLDAIELGY 45 >XP_017247823.1 PREDICTED: uncharacterized protein LOC108219077 isoform X3 [Daucus carota subsp. sativus] Length = 155 Score = 53.1 bits (126), Expect = 6e-07 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +2 Query: 80 MAIPEISLSSRNAKAMPVLGLGIGATD-PTPEVITSTINAVLEAIELGY 223 M+IP+++LSS N K+MPVLGLG A P PE++ + VLEAIELGY Sbjct: 1 MSIPQVTLSSGNVKSMPVLGLGTAAVPFPGPEIV---VKVVLEAIELGY 46 >XP_017247822.1 PREDICTED: uncharacterized protein LOC108219077 isoform X2 [Daucus carota subsp. sativus] Length = 158 Score = 53.1 bits (126), Expect = 6e-07 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +2 Query: 80 MAIPEISLSSRNAKAMPVLGLGIGATD-PTPEVITSTINAVLEAIELGY 223 M+IP+++LSS N K+MPVLGLG A P PE++ + VLEAIELGY Sbjct: 1 MSIPQVTLSSGNVKSMPVLGLGTAAVPFPGPEIV---VKVVLEAIELGY 46 >XP_017221805.1 PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Daucus carota subsp. sativus] Length = 319 Score = 54.3 bits (129), Expect = 8e-07 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = +2 Query: 80 MAIPEISLSSRNAKAMPVLGLGIGATDPTPEVITSTINAVLEAIELGY 223 M+IP+++LSS NAK MPVLGLG A DP P T + AVLEAIELGY Sbjct: 1 MSIPQVTLSSGNAKTMPVLGLGT-AADPFPGPET-VVKAVLEAIELGY 46 >XP_017247821.1 PREDICTED: uncharacterized protein LOC108219077 isoform X1 [Daucus carota subsp. sativus] Length = 191 Score = 53.1 bits (126), Expect = 1e-06 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +2 Query: 80 MAIPEISLSSRNAKAMPVLGLGIGATD-PTPEVITSTINAVLEAIELGY 223 M+IP+++LSS N K+MPVLGLG A P PE++ + VLEAIELGY Sbjct: 1 MSIPQVTLSSGNVKSMPVLGLGTAAVPFPGPEIV---VKVVLEAIELGY 46 >XP_017222800.1 PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Daucus carota subsp. sativus] Length = 323 Score = 53.9 bits (128), Expect = 1e-06 Identities = 32/48 (66%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = +2 Query: 83 AIPEISLSSRNAKAMPVLGLGIG-ATDPTPEVITSTINAVLEAIELGY 223 +IPE+SLSS +AK MPVLGLG A P PEV+ I AVLEAIELGY Sbjct: 5 SIPEVSLSSGDAKRMPVLGLGTSTAPFPKPEVV---IKAVLEAIELGY 49 >XP_017222616.1 PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Daucus carota subsp. sativus] Length = 319 Score = 52.8 bits (125), Expect = 3e-06 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = +2 Query: 80 MAIPEISLSSRNAKAMPVLGLGIGATDPTPEVITSTINAVLEAIELGY 223 M+ P+++LSS NAK MPVLGLG A DP P T + AVLEAIELGY Sbjct: 1 MSTPQVTLSSGNAKTMPVLGLGT-AADPLPGPDT-VVRAVLEAIELGY 46 >XP_017216171.1 PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Daucus carota subsp. sativus] KZM87383.1 hypothetical protein DCAR_024517 [Daucus carota subsp. sativus] Length = 323 Score = 52.8 bits (125), Expect = 3e-06 Identities = 30/48 (62%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +2 Query: 83 AIPEISLSSRNAKAMPVLGLGIGATD-PTPEVITSTINAVLEAIELGY 223 +IPE+ LSS NAKAMPVLGLG G TPE + + AVLEAIE+GY Sbjct: 5 SIPEVILSSGNAKAMPVLGLGTGGLPFVTPEAV---VKAVLEAIEVGY 49 >XP_017222615.1 PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like isoform X3 [Daucus carota subsp. sativus] Length = 322 Score = 52.0 bits (123), Expect = 5e-06 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = +2 Query: 80 MAIPEISLSSRNAKAMPVLGLGIGATDPTPEVITSTINAVLEAIELGY 223 ++IP+++LSS NA+ MPVLGLG A DP P T I AVLEAIELGY Sbjct: 4 LSIPQVTLSSGNARPMPVLGLGT-AADPFPGPET-VIKAVLEAIELGY 49 >XP_017222613.1 PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like isoform X2 [Daucus carota subsp. sativus] Length = 348 Score = 52.0 bits (123), Expect = 5e-06 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = +2 Query: 80 MAIPEISLSSRNAKAMPVLGLGIGATDPTPEVITSTINAVLEAIELGY 223 ++IP+++LSS NA+ MPVLGLG A DP P T I AVLEAIELGY Sbjct: 30 LSIPQVTLSSGNARPMPVLGLGT-AADPFPGPET-VIKAVLEAIELGY 75 >XP_017222799.1 PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Daucus carota subsp. sativus] Length = 323 Score = 51.6 bits (122), Expect = 7e-06 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = +2 Query: 83 AIPEISLSSRNAKAMPVLGLGIGATDPTPEVITSTINAVLEAIELGY 223 +IP ++LSS +AK MPVLGLG G P P + I AVLEAIELGY Sbjct: 5 SIPTVTLSSVDAKPMPVLGLGTGGYPPAPP--EAVIKAVLEAIELGY 49 >XP_017222612.1 PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like isoform X1 [Daucus carota subsp. sativus] Length = 348 Score = 51.2 bits (121), Expect = 1e-05 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = +2 Query: 80 MAIPEISLSSRNAKAMPVLGLGIGATDPTPEVITSTINAVLEAIELGY 223 +++P+++LSS NA+ MPVLGLG A DP P T I AVLEAIELGY Sbjct: 30 LSLPQVTLSSGNARPMPVLGLGT-AADPFPGPET-VIKAVLEAIELGY 75