BLASTX nr result
ID: Angelica27_contig00011904
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00011904 (413 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017251078.1 PREDICTED: leucine-rich repeat extensin-like prot... 69 9e-12 KZN09842.1 hypothetical protein DCAR_002498 [Daucus carota subsp... 69 2e-11 XP_017220968.1 PREDICTED: extensin-like [Daucus carota subsp. sa... 57 2e-07 KVH90246.1 hypothetical protein Ccrd_007757 [Cynara cardunculus ... 55 1e-06 XP_011100836.1 PREDICTED: leucine-rich repeat extensin-like prot... 54 5e-06 >XP_017251078.1 PREDICTED: leucine-rich repeat extensin-like protein 1 [Daucus carota subsp. sativus] Length = 178 Score = 68.6 bits (166), Expect = 9e-12 Identities = 33/56 (58%), Positives = 39/56 (69%), Gaps = 7/56 (12%) Frame = -3 Query: 372 MKITTKSTLPPLTFLIINLFFSRNIASNS-------WVGSKYEVACTMCSACDNPC 226 M+ITTK LP LTFL I L S ++AS+S W GSKYE+ CTMC+ACDNPC Sbjct: 1 MRITTKLKLPLLTFLSITLSLSTHVASSSNSAATSTWAGSKYEIQCTMCAACDNPC 56 >KZN09842.1 hypothetical protein DCAR_002498 [Daucus carota subsp. sativus] Length = 217 Score = 68.6 bits (166), Expect = 2e-11 Identities = 33/56 (58%), Positives = 39/56 (69%), Gaps = 7/56 (12%) Frame = -3 Query: 372 MKITTKSTLPPLTFLIINLFFSRNIASNS-------WVGSKYEVACTMCSACDNPC 226 M+ITTK LP LTFL I L S ++AS+S W GSKYE+ CTMC+ACDNPC Sbjct: 1 MRITTKLKLPLLTFLSITLSLSTHVASSSNSAATSTWAGSKYEIQCTMCAACDNPC 56 >XP_017220968.1 PREDICTED: extensin-like [Daucus carota subsp. sativus] KZM85550.1 hypothetical protein DCAR_027028 [Daucus carota subsp. sativus] Length = 169 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 5/49 (10%) Frame = -3 Query: 357 KSTLPPLT----FLIINLFFSRNIAS-NSWVGSKYEVACTMCSACDNPC 226 K+ LP T F+++ L S I S N+W GSKYEV CTMC+ACDNPC Sbjct: 2 KTILPSRTSLNIFILLQLLISSRIVSANTWAGSKYEVECTMCAACDNPC 50 >KVH90246.1 hypothetical protein Ccrd_007757 [Cynara cardunculus var. scolymus] Length = 166 Score = 55.1 bits (131), Expect = 1e-06 Identities = 23/47 (48%), Positives = 29/47 (61%) Frame = -3 Query: 366 ITTKSTLPPLTFLIINLFFSRNIASNSWVGSKYEVACTMCSACDNPC 226 + K + L L+I S SN WVGSKY++ CTMC+ACDNPC Sbjct: 2 VVVKQKVNTLILLLIASLLSIVAESNKWVGSKYQIECTMCAACDNPC 48 >XP_011100836.1 PREDICTED: leucine-rich repeat extensin-like protein 6 [Sesamum indicum] Length = 180 Score = 53.5 bits (127), Expect = 5e-06 Identities = 28/51 (54%), Positives = 32/51 (62%), Gaps = 13/51 (25%) Frame = -3 Query: 339 LTFLIINLFFSRN------IASN-------SWVGSKYEVACTMCSACDNPC 226 L FL+I L SRN IA N +WVGSKY++ CTMCSACDNPC Sbjct: 13 LLFLLIVLIASRNEGLVLVIAKNDTYTTTATWVGSKYQIECTMCSACDNPC 63