BLASTX nr result
ID: Angelica27_contig00011863
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00011863 (279 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017232742.1 PREDICTED: uncharacterized protein LOC108206838 [... 62 4e-10 >XP_017232742.1 PREDICTED: uncharacterized protein LOC108206838 [Daucus carota subsp. sativus] KZN04614.1 hypothetical protein DCAR_005451 [Daucus carota subsp. sativus] Length = 135 Score = 61.6 bits (148), Expect = 4e-10 Identities = 39/62 (62%), Positives = 43/62 (69%), Gaps = 7/62 (11%) Frame = +3 Query: 108 MNHSLISSTAVAVASP-PISHKHIVNAAP------TVSYHKIVSSQSDQPQDCRLVHRRR 266 M SLISST VAVA+ PISHK +NAAP T+SYHKIV+S SD PQ CR V RR Sbjct: 1 MIQSLISSTTVAVAAAVPISHK--INAAPPPPPLPTLSYHKIVASHSDGPQHCRPVQRRA 58 Query: 267 AT 272 AT Sbjct: 59 AT 60