BLASTX nr result
ID: Angelica27_contig00011684
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00011684 (268 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017254391.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 69 8e-14 CDP15082.1 unnamed protein product [Coffea canephora] 58 3e-10 XP_016744391.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 56 1e-09 XP_017627338.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 56 1e-09 XP_012468599.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 56 1e-09 KJB08078.1 hypothetical protein B456_001G062300 [Gossypium raimo... 56 1e-09 KJB08080.1 hypothetical protein B456_001G062300 [Gossypium raimo... 56 1e-09 XP_004137576.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 52 3e-09 XP_010037482.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 56 4e-09 XP_012079935.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 55 6e-09 XP_006439990.1 hypothetical protein CICLE_v10020762mg [Citrus cl... 57 8e-09 XP_006439989.1 hypothetical protein CICLE_v10020762mg [Citrus cl... 57 8e-09 GAV62549.1 BTB domain-containing protein/zf-TAZ domain-containin... 53 1e-08 XP_008439713.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 53 1e-08 XP_006476936.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 56 1e-08 XP_009802586.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 48 1e-08 OMP09209.1 Zinc finger, TAZ-type [Corchorus olitorius] 53 2e-08 XP_018849609.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 55 2e-08 XP_017184797.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 58 3e-08 OAY30760.1 hypothetical protein MANES_14G056500 [Manihot esculenta] 52 3e-08 >XP_017254391.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Daucus carota subsp. sativus] KZM91036.1 hypothetical protein DCAR_021599 [Daucus carota subsp. sativus] Length = 361 Score = 68.6 bits (166), Expect(2) = 8e-14 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIPAHASVLASASPVLESI+DSPRKHRSSENTI+IL Sbjct: 38 RIPAHASVLASASPVLESIIDSPRKHRSSENTIRIL 73 Score = 35.4 bits (80), Expect(2) = 8e-14 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +1 Query: 121 DVHIITSGGLRIPAHS 168 DVHIITSGGLRIPAH+ Sbjct: 28 DVHIITSGGLRIPAHA 43 >CDP15082.1 unnamed protein product [Coffea canephora] Length = 355 Score = 57.8 bits (138), Expect(2) = 3e-10 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIPA+++VLASASPVLESI+D PRKHRSS+ TI IL Sbjct: 37 RIPANSAVLASASPVLESIIDRPRKHRSSDKTISIL 72 Score = 34.3 bits (77), Expect(2) = 3e-10 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = +1 Query: 118 ADVHIITSGGLRIPAHS 168 ADVHIITSGG+RIPA+S Sbjct: 26 ADVHIITSGGVRIPANS 42 >XP_016744391.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Gossypium hirsutum] Length = 380 Score = 55.8 bits (133), Expect(2) = 1e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIPAH+S+LA ASPVLE+I++ PRKHRSSE I IL Sbjct: 30 RIPAHSSILAMASPVLENIIEQPRKHRSSERVIPIL 65 Score = 33.9 bits (76), Expect(2) = 1e-09 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 121 DVHIITSGGLRIPAHS 168 D+HI+TSGG RIPAHS Sbjct: 20 DIHILTSGGFRIPAHS 35 >XP_017627338.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Gossypium arboreum] KHG25087.1 BTB/POZ and TAZ domain-containing 1 -like protein [Gossypium arboreum] Length = 356 Score = 55.8 bits (133), Expect(2) = 1e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIPAH+S+LA ASPVLE+I++ PRKHRSSE I IL Sbjct: 30 RIPAHSSILAMASPVLENIIEQPRKHRSSERVIPIL 65 Score = 33.9 bits (76), Expect(2) = 1e-09 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 121 DVHIITSGGLRIPAHS 168 D+HI+TSGG RIPAHS Sbjct: 20 DIHILTSGGFRIPAHS 35 >XP_012468599.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Gossypium raimondii] KJB08079.1 hypothetical protein B456_001G062300 [Gossypium raimondii] Length = 355 Score = 55.8 bits (133), Expect(2) = 1e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIPAH+S+LA ASPVLE+I++ PRKHRSSE I IL Sbjct: 30 RIPAHSSILAMASPVLENIIEQPRKHRSSERVIPIL 65 Score = 33.9 bits (76), Expect(2) = 1e-09 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 121 DVHIITSGGLRIPAHS 168 D+HI+TSGG RIPAHS Sbjct: 20 DIHILTSGGFRIPAHS 35 >KJB08078.1 hypothetical protein B456_001G062300 [Gossypium raimondii] Length = 313 Score = 55.8 bits (133), Expect(2) = 1e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIPAH+S+LA ASPVLE+I++ PRKHRSSE I IL Sbjct: 30 RIPAHSSILAMASPVLENIIEQPRKHRSSERVIPIL 65 Score = 33.9 bits (76), Expect(2) = 1e-09 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 121 DVHIITSGGLRIPAHS 168 D+HI+TSGG RIPAHS Sbjct: 20 DIHILTSGGFRIPAHS 35 >KJB08080.1 hypothetical protein B456_001G062300 [Gossypium raimondii] Length = 291 Score = 55.8 bits (133), Expect(2) = 1e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIPAH+S+LA ASPVLE+I++ PRKHRSSE I IL Sbjct: 30 RIPAHSSILAMASPVLENIIEQPRKHRSSERVIPIL 65 Score = 33.9 bits (76), Expect(2) = 1e-09 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 121 DVHIITSGGLRIPAHS 168 D+HI+TSGG RIPAHS Sbjct: 20 DIHILTSGGFRIPAHS 35 >XP_004137576.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Cucumis sativus] KGN63975.1 Protein binding protein [Cucumis sativus] Length = 366 Score = 52.4 bits (124), Expect(2) = 3e-09 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIPAH++VLAS S VLE++++ PRKHRSSE IQ+L Sbjct: 43 RIPAHSTVLASVSSVLENMIEQPRKHRSSEKVIQML 78 Score = 36.2 bits (82), Expect(2) = 3e-09 Identities = 14/17 (82%), Positives = 17/17 (100%) Frame = +1 Query: 118 ADVHIITSGGLRIPAHS 168 +D+HI+TSGGLRIPAHS Sbjct: 32 SDIHIVTSGGLRIPAHS 48 >XP_010037482.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Eucalyptus grandis] KCW49189.1 hypothetical protein EUGRSUZ_K02768 [Eucalyptus grandis] Length = 376 Score = 56.2 bits (134), Expect(2) = 4e-09 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIPAH+ +LAS SPVLE+I+D PRKHRSSE I IL Sbjct: 52 RIPAHSGILASVSPVLENIIDQPRKHRSSERVIPIL 87 Score = 32.0 bits (71), Expect(2) = 4e-09 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 121 DVHIITSGGLRIPAHS 168 DV I+TSGGLRIPAHS Sbjct: 42 DVWILTSGGLRIPAHS 57 >XP_012079935.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Jatropha curcas] KDP30995.1 hypothetical protein JCGZ_11371 [Jatropha curcas] Length = 362 Score = 55.1 bits (131), Expect(2) = 6e-09 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIPAH+S+LAS SPVLE+I+D PRKHR SE I IL Sbjct: 46 RIPAHSSILASVSPVLENIIDRPRKHRRSERIIPIL 81 Score = 32.3 bits (72), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +1 Query: 118 ADVHIITSGGLRIPAHS 168 ADV IITS GLRIPAHS Sbjct: 35 ADVQIITSDGLRIPAHS 51 >XP_006439990.1 hypothetical protein CICLE_v10020762mg [Citrus clementina] ESR53230.1 hypothetical protein CICLE_v10020762mg [Citrus clementina] KDO69412.1 hypothetical protein CISIN_1g017954mg [Citrus sinensis] Length = 363 Score = 57.0 bits (136), Expect(2) = 8e-09 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIP HAS+L SASPVLE+I+D PRKHRSSE I IL Sbjct: 45 RIPVHASILVSASPVLENIIDRPRKHRSSEKVIPIL 80 Score = 30.0 bits (66), Expect(2) = 8e-09 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +1 Query: 121 DVHIITSGGLRIPAHS 168 DV I+TSGGLRIP H+ Sbjct: 35 DVQILTSGGLRIPVHA 50 >XP_006439989.1 hypothetical protein CICLE_v10020762mg [Citrus clementina] ESR53229.1 hypothetical protein CICLE_v10020762mg [Citrus clementina] KDO69413.1 hypothetical protein CISIN_1g017954mg [Citrus sinensis] Length = 305 Score = 57.0 bits (136), Expect(2) = 8e-09 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIP HAS+L SASPVLE+I+D PRKHRSSE I IL Sbjct: 45 RIPVHASILVSASPVLENIIDRPRKHRSSEKVIPIL 80 Score = 30.0 bits (66), Expect(2) = 8e-09 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +1 Query: 121 DVHIITSGGLRIPAHS 168 DV I+TSGGLRIP H+ Sbjct: 35 DVQILTSGGLRIPVHA 50 >GAV62549.1 BTB domain-containing protein/zf-TAZ domain-containing protein [Cephalotus follicularis] Length = 368 Score = 52.8 bits (125), Expect(2) = 1e-08 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIPAH+ +LAS S VLE+I+D PRKHRSSE I IL Sbjct: 47 RIPAHSGILASVSAVLENIIDRPRKHRSSEKVIPIL 82 Score = 33.9 bits (76), Expect(2) = 1e-08 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +1 Query: 19 QSTTPHLTSQKTLFISTKSRVYTYTYLSLNNNVADVHIITSGGLRIPAHS 168 +S+T T+ T + T + T S D+ I+TS GLRIPAHS Sbjct: 3 KSSTHDTTTTTTTAVKTTTTTTTIKQSSRELPEPDLQILTSSGLRIPAHS 52 >XP_008439713.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Cucumis melo] Length = 366 Score = 53.1 bits (126), Expect(2) = 1e-08 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIPAH+++LAS S VLE++++ PRKHRSSE IQIL Sbjct: 43 RIPAHSTILASVSSVLENMIEQPRKHRSSEKVIQIL 78 Score = 33.5 bits (75), Expect(2) = 1e-08 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +1 Query: 121 DVHIITSGGLRIPAHS 168 D+HI+TS GLRIPAHS Sbjct: 33 DIHIVTSAGLRIPAHS 48 >XP_006476936.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Citrus sinensis] Length = 363 Score = 56.2 bits (134), Expect(2) = 1e-08 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIP HAS+L SASPVLE+I D PRKHRSSE I IL Sbjct: 45 RIPVHASILVSASPVLENITDRPRKHRSSEKVIPIL 80 Score = 30.0 bits (66), Expect(2) = 1e-08 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +1 Query: 121 DVHIITSGGLRIPAHS 168 DV I+TSGGLRIP H+ Sbjct: 35 DVQILTSGGLRIPVHA 50 >XP_009802586.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Nicotiana sylvestris] XP_016459256.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Nicotiana tabacum] Length = 297 Score = 48.1 bits (113), Expect(2) = 1e-08 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIPAH++VLA+ S VLESI+ P+K RSSE TI++L Sbjct: 36 RIPAHSTVLAATSTVLESILVRPQKRRSSEKTIRVL 71 Score = 38.1 bits (87), Expect(2) = 1e-08 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 118 ADVHIITSGGLRIPAHS 168 ADVHIITSGGLRIPAHS Sbjct: 25 ADVHIITSGGLRIPAHS 41 >OMP09209.1 Zinc finger, TAZ-type [Corchorus olitorius] Length = 359 Score = 52.8 bits (125), Expect(2) = 2e-08 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIPAH+S+LA SPVLE+I+D P KHRSSE I IL Sbjct: 39 RIPAHSSILAMVSPVLENIIDRPLKHRSSERVIPIL 74 Score = 32.7 bits (73), Expect(2) = 2e-08 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 121 DVHIITSGGLRIPAHS 168 DV I+TSGGLRIPAHS Sbjct: 29 DVEILTSGGLRIPAHS 44 >XP_018849609.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Juglans regia] Length = 206 Score = 54.7 bits (130), Expect(2) = 2e-08 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIP H+S+LAS SPVLE+++D PRKHRSSE I IL Sbjct: 40 RIPVHSSILASVSPVLENMIDRPRKHRSSERVIPIL 75 Score = 30.8 bits (68), Expect(2) = 2e-08 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +1 Query: 121 DVHIITSGGLRIPAHS 168 D+HI+TSG LRIP HS Sbjct: 30 DLHILTSGALRIPVHS 45 >XP_017184797.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Malus domestica] Length = 202 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +2 Query: 149 CAFRRIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 C RIPAH+S+LAS SPVLE+++D PRKHRSSE I IL Sbjct: 34 CDALRIPAHSSILASVSPVLENVIDRPRKHRSSERVIPIL 73 >OAY30760.1 hypothetical protein MANES_14G056500 [Manihot esculenta] Length = 362 Score = 51.6 bits (122), Expect(2) = 3e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +2 Query: 161 RIPAHASVLASASPVLESIMDSPRKHRSSENTIQIL 268 RIPAH+SVLAS S VLE+I+D P KHRSSE I IL Sbjct: 44 RIPAHSSVLASVSSVLENIIDRPLKHRSSERIIPIL 79 Score = 33.5 bits (75), Expect(2) = 3e-08 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +1 Query: 121 DVHIITSGGLRIPAHS 168 DV IITSGGLRIPAHS Sbjct: 34 DVQIITSGGLRIPAHS 49