BLASTX nr result
ID: Angelica27_contig00011658
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00011658 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017219090.1 PREDICTED: uncharacterized protein LOC108196349 [... 93 7e-20 XP_015087654.1 PREDICTED: ankyrin repeat domain-containing prote... 87 1e-17 XP_004247835.1 PREDICTED: ankyrin repeat domain-containing prote... 87 1e-17 XP_016566088.1 PREDICTED: ankyrin repeat domain-containing prote... 86 2e-17 AGA60919.1 hypothetical protein, partial [Mimulus sookensis] AGA... 80 2e-17 XP_016503327.1 PREDICTED: ankyrin repeat domain-containing prote... 86 3e-17 XP_009621286.1 PREDICTED: ankyrin repeat domain-containing prote... 86 3e-17 XP_019233741.1 PREDICTED: ankyrin repeat domain-containing prote... 86 3e-17 XP_019166097.1 PREDICTED: ankyrin repeat domain-containing prote... 85 5e-17 CDO99416.1 unnamed protein product [Coffea canephora] 85 7e-17 XP_009793945.1 PREDICTED: ankyrin repeat domain-containing prote... 85 7e-17 XP_006360337.1 PREDICTED: ankyrin repeat domain-containing prote... 85 7e-17 AGA60918.1 hypothetical protein, partial [Mimulus sookensis] AGA... 79 9e-17 OAY55388.1 hypothetical protein MANES_03G149900 [Manihot esculen... 84 1e-16 OAY55387.1 hypothetical protein MANES_03G149900 [Manihot esculenta] 84 1e-16 KVH91002.1 Ankyrin repeat-containing protein [Cynara cardunculus... 84 1e-16 XP_011034459.1 PREDICTED: ankyrin repeat domain-containing prote... 84 2e-16 AGA61019.1 hypothetical protein, partial [Erythranthe geyeri] 78 2e-16 XP_002299280.2 hypothetical protein POPTR_0001s14330g, partial [... 83 2e-16 XP_002518131.1 PREDICTED: ankyrin repeat domain-containing prote... 83 3e-16 >XP_017219090.1 PREDICTED: uncharacterized protein LOC108196349 [Daucus carota subsp. sativus] XP_017219091.1 PREDICTED: uncharacterized protein LOC108196349 [Daucus carota subsp. sativus] Length = 650 Score = 93.2 bits (230), Expect = 7e-20 Identities = 49/67 (73%), Positives = 52/67 (77%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 MSGLDVS+YAHS VH+AVVTKDYAALRKIIAGLPQLC PA AKADAIST Sbjct: 1 MSGLDVSKYAHSRVHRAVVTKDYAALRKIIAGLPQLCHPAEIVSESVSVAEEAKADAIST 60 Query: 314 VIDCRNV 334 VID R+V Sbjct: 61 VIDSRDV 67 >XP_015087654.1 PREDICTED: ankyrin repeat domain-containing protein 13C-A-like [Solanum pennellii] Length = 652 Score = 86.7 bits (213), Expect = 1e-17 Identities = 43/67 (64%), Positives = 50/67 (74%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+G+DVS+YAHSPVHK +V KDYA+LRKIIA LP+LCDPA AKADAIS Sbjct: 1 MAGIDVSKYAHSPVHKGIVLKDYASLRKIIAALPRLCDPAEIHTEAVSLAEEAKADAISA 60 Query: 314 VIDCRNV 334 VID R+V Sbjct: 61 VIDRRDV 67 >XP_004247835.1 PREDICTED: ankyrin repeat domain-containing protein 13C-A-like [Solanum lycopersicum] Length = 652 Score = 86.7 bits (213), Expect = 1e-17 Identities = 43/67 (64%), Positives = 50/67 (74%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+G+DVS+YAHSPVHK +V KDYA+LRKIIA LP+LCDPA AKADAIS Sbjct: 1 MAGIDVSKYAHSPVHKGIVLKDYASLRKIIAALPRLCDPAEIHTEAVSLAEEAKADAISA 60 Query: 314 VIDCRNV 334 VID R+V Sbjct: 61 VIDRRDV 67 >XP_016566088.1 PREDICTED: ankyrin repeat domain-containing protein 13C [Capsicum annuum] XP_016566089.1 PREDICTED: ankyrin repeat domain-containing protein 13C [Capsicum annuum] Length = 656 Score = 86.3 bits (212), Expect = 2e-17 Identities = 42/67 (62%), Positives = 50/67 (74%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+G DVS+Y HSPVHKA++ KDYA+LRKIIAGLP+LCDP AKADAIS+ Sbjct: 1 MAGTDVSKYGHSPVHKAIILKDYASLRKIIAGLPRLCDPTEIHTEAVSLAEEAKADAISS 60 Query: 314 VIDCRNV 334 VID R+V Sbjct: 61 VIDRRDV 67 >AGA60919.1 hypothetical protein, partial [Mimulus sookensis] AGA60921.1 hypothetical protein, partial [Mimulus sookensis] AGA60922.1 hypothetical protein, partial [Mimulus sookensis] AGA60923.1 hypothetical protein, partial [Mimulus sookensis] AGA60924.1 hypothetical protein, partial [Mimulus sookensis] AGA60925.1 hypothetical protein, partial [Mimulus sookensis] AGA60926.1 hypothetical protein, partial [Mimulus sookensis] AGA60927.1 hypothetical protein, partial [Mimulus sookensis] AGA60929.1 hypothetical protein, partial [Mimulus sookensis] AGA60931.1 hypothetical protein, partial [Mimulus sookensis] AGA60933.1 hypothetical protein, partial [Mimulus sookensis] AGA60934.1 hypothetical protein, partial [Erythranthe guttata] AGA60935.1 hypothetical protein, partial [Erythranthe guttata] AGA60936.1 hypothetical protein, partial [Erythranthe guttata] AGA60937.1 hypothetical protein, partial [Erythranthe guttata] AGA60939.1 hypothetical protein, partial [Mimulus sookensis] AGA60941.1 hypothetical protein, partial [Mimulus sookensis] AGA60942.1 hypothetical protein, partial [Mimulus sookensis] AGA60943.1 hypothetical protein, partial [Mimulus sookensis] AGA60944.1 hypothetical protein, partial [Mimulus sookensis] AGA60945.1 hypothetical protein, partial [Mimulus sookensis] AGA60946.1 hypothetical protein, partial [Erythranthe guttata] AGA60947.1 hypothetical protein, partial [Erythranthe guttata] AGA60948.1 hypothetical protein, partial [Mimulus sookensis] AGA60949.1 hypothetical protein, partial [Mimulus sookensis] AGA60951.1 hypothetical protein, partial [Mimulus sookensis] AGA60953.1 hypothetical protein, partial [Mimulus sookensis] AGA60955.1 hypothetical protein, partial [Mimulus sookensis] AGA60957.1 hypothetical protein, partial [Mimulus sookensis] AGA60958.1 hypothetical protein, partial [Mimulus sookensis] AGA60959.1 hypothetical protein, partial [Mimulus sookensis] AGA60960.1 hypothetical protein, partial [Mimulus sookensis] AGA60961.1 hypothetical protein, partial [Mimulus sookensis] AGA60962.1 hypothetical protein, partial [Mimulus sookensis] AGA60963.1 hypothetical protein, partial [Mimulus sookensis] AGA60964.1 hypothetical protein, partial [Mimulus sookensis] AGA60965.1 hypothetical protein, partial [Mimulus sookensis] AGA60966.1 hypothetical protein, partial [Erythranthe guttata] AGA60967.1 hypothetical protein, partial [Erythranthe guttata] AGA60968.1 hypothetical protein, partial [Erythranthe guttata] AGA60969.1 hypothetical protein, partial [Erythranthe guttata] AGA60970.1 hypothetical protein, partial [Mimulus sookensis] AGA60971.1 hypothetical protein, partial [Mimulus sookensis] AGA60972.1 hypothetical protein, partial [Mimulus sookensis] AGA60973.1 hypothetical protein, partial [Mimulus sookensis] AGA60975.1 hypothetical protein, partial [Mimulus sookensis] AGA60976.1 hypothetical protein, partial [Erythranthe guttata] AGA60977.1 hypothetical protein, partial [Erythranthe guttata] AGA60979.1 hypothetical protein, partial [Mimulus sookensis] AGA60981.1 hypothetical protein, partial [Mimulus sookensis] AGA60982.1 hypothetical protein, partial [Erythranthe guttata] AGA60983.1 hypothetical protein, partial [Erythranthe guttata] AGA60984.1 hypothetical protein, partial [Erythranthe guttata] AGA60985.1 hypothetical protein, partial [Erythranthe guttata] AGA60986.1 hypothetical protein, partial [Erythranthe guttata] AGA60987.1 hypothetical protein, partial [Erythranthe guttata] AGA60988.1 hypothetical protein, partial [Erythranthe nasuta] AGA60989.1 hypothetical protein, partial [Erythranthe guttata] AGA60990.1 hypothetical protein, partial [Erythranthe guttata] AGA60991.1 hypothetical protein, partial [Erythranthe guttata] AGA60992.1 hypothetical protein, partial [Erythranthe guttata] AGA60993.1 hypothetical protein, partial [Erythranthe guttata] AGA60994.1 hypothetical protein, partial [Erythranthe nasuta] AGA60995.1 hypothetical protein, partial [Erythranthe guttata] AGA60996.1 hypothetical protein, partial [Erythranthe guttata] AGA60997.1 hypothetical protein, partial [Erythranthe guttata] AGA60998.1 hypothetical protein, partial [Erythranthe guttata] AGA60999.1 hypothetical protein, partial [Erythranthe guttata] AGA61000.1 hypothetical protein, partial [Erythranthe guttata] AGA61001.1 hypothetical protein, partial [Erythranthe guttata] AGA61002.1 hypothetical protein, partial [Erythranthe guttata] AGA61003.1 hypothetical protein, partial [Erythranthe guttata] AGA61004.1 hypothetical protein, partial [Erythranthe guttata] AGA61005.1 hypothetical protein, partial [Erythranthe guttata] AGA61006.1 hypothetical protein, partial [Erythranthe nasuta] AGA61007.1 hypothetical protein, partial [Erythranthe guttata] AGA61008.1 hypothetical protein, partial [Erythranthe nasuta] AGA61009.1 hypothetical protein, partial [Erythranthe nasuta] AGA61010.1 hypothetical protein, partial [Erythranthe nasuta] AGA61011.1 hypothetical protein, partial [Erythranthe guttata] AGA61012.1 hypothetical protein, partial [Erythranthe guttata] AGA61013.1 hypothetical protein, partial [Erythranthe guttata] AGA61014.1 hypothetical protein, partial [Erythranthe guttata] AGA61015.1 hypothetical protein, partial [Erythranthe guttata] AGA61016.1 hypothetical protein, partial [Erythranthe guttata] AGA61017.1 hypothetical protein, partial [Erythranthe guttata] AGA61018.1 hypothetical protein, partial [Erythranthe guttata] AGA61020.1 hypothetical protein, partial [Erythranthe nasuta] AGA61021.1 hypothetical protein, partial [Erythranthe guttata] AGA61022.1 hypothetical protein, partial [Erythranthe guttata] AGA61023.1 hypothetical protein, partial [Erythranthe nasuta] AGA61024.1 hypothetical protein, partial [Erythranthe guttata] AGA61025.1 hypothetical protein, partial [Erythranthe guttata] AGA61026.1 hypothetical protein, partial [Erythranthe guttata] AGA61027.1 hypothetical protein, partial [Erythranthe nasuta] AGA61028.1 hypothetical protein, partial [Erythranthe guttata] AGA61029.1 hypothetical protein, partial [Erythranthe nasuta] AGA61030.1 hypothetical protein, partial [Erythranthe guttata] AGA61031.1 hypothetical protein, partial [Erythranthe guttata] AGA61032.1 hypothetical protein, partial [Erythranthe guttata] AGA61033.1 hypothetical protein, partial [Erythranthe guttata] AGA61034.1 hypothetical protein, partial [Erythranthe guttata] AGA61035.1 hypothetical protein, partial [Erythranthe guttata] AGA61036.1 hypothetical protein, partial [Erythranthe guttata] AGA61037.1 hypothetical protein, partial [Erythranthe guttata] AGA61038.1 hypothetical protein, partial [Erythranthe nasuta] AGA61039.1 hypothetical protein, partial [Erythranthe nasuta] AGA61040.1 hypothetical protein, partial [Erythranthe nasuta] AGA61041.1 hypothetical protein, partial [Erythranthe nasuta] AGA61042.1 hypothetical protein, partial [Erythranthe guttata] AGA61043.1 hypothetical protein, partial [Erythranthe guttata] AGA61044.1 hypothetical protein, partial [Erythranthe guttata] AGA61045.1 hypothetical protein, partial [Erythranthe guttata] AGA61046.1 hypothetical protein, partial [Erythranthe guttata] AGA61047.1 hypothetical protein, partial [Erythranthe nasuta] AGA61048.1 hypothetical protein, partial [Erythranthe guttata] AGA61049.1 hypothetical protein, partial [Erythranthe guttata] AGA61050.1 hypothetical protein, partial [Erythranthe guttata] AGA61051.1 hypothetical protein, partial [Erythranthe guttata] AGA61052.1 hypothetical protein, partial [Erythranthe guttata] AGA61053.1 hypothetical protein, partial [Erythranthe guttata] AGA61054.1 hypothetical protein, partial [Mimulus sookensis] AGA61055.1 hypothetical protein, partial [Mimulus sookensis] AGA61056.1 hypothetical protein, partial [Mimulus sookensis] AGA61057.1 hypothetical protein, partial [Erythranthe guttata] AGA61058.1 hypothetical protein, partial [Erythranthe nasuta] Length = 113 Score = 80.5 bits (197), Expect = 2e-17 Identities = 39/67 (58%), Positives = 47/67 (70%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 MS +DVS+Y HSPVHKA++ KDYA LRKIIAGLP+LCDP+ AKAD I+ Sbjct: 1 MSSVDVSKYEHSPVHKAIILKDYAGLRKIIAGLPRLCDPSEIHTESVSLAEEAKADIIAA 60 Query: 314 VIDCRNV 334 ID R+V Sbjct: 61 AIDRRDV 67 >XP_016503327.1 PREDICTED: ankyrin repeat domain-containing protein 13C-B [Nicotiana tabacum] Length = 649 Score = 85.9 bits (211), Expect = 3e-17 Identities = 43/67 (64%), Positives = 50/67 (74%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+G+DVS+YAHSPVHKA+V KDYA+LRKIIA LP+LCDPA KADAIS Sbjct: 1 MAGIDVSKYAHSPVHKALVLKDYASLRKIIAALPRLCDPAEIHTESLSLTEEVKADAISA 60 Query: 314 VIDCRNV 334 VID R+V Sbjct: 61 VIDRRDV 67 >XP_009621286.1 PREDICTED: ankyrin repeat domain-containing protein 13C-B [Nicotiana tomentosiformis] XP_009621292.1 PREDICTED: ankyrin repeat domain-containing protein 13C-B [Nicotiana tomentosiformis] Length = 649 Score = 85.9 bits (211), Expect = 3e-17 Identities = 43/67 (64%), Positives = 50/67 (74%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+G+DVS+YAHSPVHKA+V KDYA+LRKIIA LP+LCDPA KADAIS Sbjct: 1 MAGIDVSKYAHSPVHKALVLKDYASLRKIIAALPRLCDPAEIHTESLSLAEEVKADAISA 60 Query: 314 VIDCRNV 334 VID R+V Sbjct: 61 VIDRRDV 67 >XP_019233741.1 PREDICTED: ankyrin repeat domain-containing protein 13C-B [Nicotiana attenuata] OIT06821.1 hypothetical protein A4A49_10126 [Nicotiana attenuata] Length = 651 Score = 85.9 bits (211), Expect = 3e-17 Identities = 43/67 (64%), Positives = 50/67 (74%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+G+DVS+YAHSPVHKA+V KDYA+LRKIIA LP+LCDPA KADAIS Sbjct: 1 MAGIDVSKYAHSPVHKALVLKDYASLRKIIAALPRLCDPAEIHTESVSLAEEVKADAISA 60 Query: 314 VIDCRNV 334 VID R+V Sbjct: 61 VIDRRDV 67 >XP_019166097.1 PREDICTED: ankyrin repeat domain-containing protein 13C-like [Ipomoea nil] Length = 650 Score = 85.1 bits (209), Expect = 5e-17 Identities = 41/67 (61%), Positives = 50/67 (74%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+G +VS+YAHSPVHKA++ KDYA+LR+IIAGLP+LCDPA AK DAIS Sbjct: 1 MAGFEVSKYAHSPVHKAIILKDYASLRRIIAGLPRLCDPAEIHSESTSVAEEAKVDAISA 60 Query: 314 VIDCRNV 334 VID R+V Sbjct: 61 VIDRRDV 67 >CDO99416.1 unnamed protein product [Coffea canephora] Length = 635 Score = 84.7 bits (208), Expect = 7e-17 Identities = 41/67 (61%), Positives = 49/67 (73%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+ +DV +YAHSPVHKA++ KDYA LR+IIAGLP+LCDPA AKADAIS Sbjct: 1 MASIDVGKYAHSPVHKAIILKDYAGLRRIIAGLPRLCDPAEIHSEAVSVAEEAKADAISV 60 Query: 314 VIDCRNV 334 VID R+V Sbjct: 61 VIDRRDV 67 >XP_009793945.1 PREDICTED: ankyrin repeat domain-containing protein 13C-B [Nicotiana sylvestris] XP_009793946.1 PREDICTED: ankyrin repeat domain-containing protein 13C-B [Nicotiana sylvestris] Length = 651 Score = 84.7 bits (208), Expect = 7e-17 Identities = 43/67 (64%), Positives = 50/67 (74%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+G+DVS+YAHSPVHKA+V KDYA+LRKIIA LP+LCDPA KADAIS Sbjct: 1 MAGIDVSKYAHSPVHKALVLKDYASLRKIIAVLPRLCDPAEIHTESVSLAEEVKADAISA 60 Query: 314 VIDCRNV 334 VID R+V Sbjct: 61 VIDRRDV 67 >XP_006360337.1 PREDICTED: ankyrin repeat domain-containing protein 13C-A-like [Solanum tuberosum] Length = 652 Score = 84.7 bits (208), Expect = 7e-17 Identities = 42/67 (62%), Positives = 49/67 (73%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+G+DVS+YAHSPVHK +V KDY +LRKIIA LP+LCDPA AKADAIS Sbjct: 1 MAGIDVSKYAHSPVHKGIVLKDYPSLRKIIAALPRLCDPAEIHTEAVSLAEEAKADAISA 60 Query: 314 VIDCRNV 334 VID R+V Sbjct: 61 VIDQRDV 67 >AGA60918.1 hypothetical protein, partial [Mimulus sookensis] AGA60920.1 hypothetical protein, partial [Mimulus sookensis] AGA60928.1 hypothetical protein, partial [Mimulus sookensis] AGA60930.1 hypothetical protein, partial [Mimulus sookensis] AGA60932.1 hypothetical protein, partial [Mimulus sookensis] AGA60938.1 hypothetical protein, partial [Mimulus sookensis] AGA60940.1 hypothetical protein, partial [Mimulus sookensis] AGA60950.1 hypothetical protein, partial [Mimulus sookensis] AGA60952.1 hypothetical protein, partial [Mimulus sookensis] AGA60954.1 hypothetical protein, partial [Mimulus sookensis] AGA60956.1 hypothetical protein, partial [Mimulus sookensis] AGA60974.1 hypothetical protein, partial [Mimulus sookensis] AGA60978.1 hypothetical protein, partial [Mimulus sookensis] AGA60980.1 hypothetical protein, partial [Mimulus sookensis] Length = 113 Score = 79.0 bits (193), Expect = 9e-17 Identities = 38/67 (56%), Positives = 47/67 (70%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 MS +DVS+Y HSPVHKA++ KDYA LRKIIAGLP+LCDP+ A+AD I+ Sbjct: 1 MSSVDVSKYEHSPVHKAIILKDYAGLRKIIAGLPRLCDPSEIHTESVSLAEEAEADIIAA 60 Query: 314 VIDCRNV 334 ID R+V Sbjct: 61 AIDRRDV 67 >OAY55388.1 hypothetical protein MANES_03G149900 [Manihot esculenta] OAY55389.1 hypothetical protein MANES_03G149900 [Manihot esculenta] Length = 551 Score = 84.0 bits (206), Expect = 1e-16 Identities = 39/67 (58%), Positives = 49/67 (73%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+G+D+S+YAHSPVHKA+ T+DYA LRKI+AGLP+LCDPA KAD I+ Sbjct: 1 MAGIDISKYAHSPVHKAIATRDYATLRKILAGLPRLCDPAEIRTEAVSLVEEEKADTIAA 60 Query: 314 VIDCRNV 334 VID R+V Sbjct: 61 VIDRRDV 67 >OAY55387.1 hypothetical protein MANES_03G149900 [Manihot esculenta] Length = 651 Score = 84.0 bits (206), Expect = 1e-16 Identities = 39/67 (58%), Positives = 49/67 (73%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+G+D+S+YAHSPVHKA+ T+DYA LRKI+AGLP+LCDPA KAD I+ Sbjct: 1 MAGIDISKYAHSPVHKAIATRDYATLRKILAGLPRLCDPAEIRTEAVSLVEEEKADTIAA 60 Query: 314 VIDCRNV 334 VID R+V Sbjct: 61 VIDRRDV 67 >KVH91002.1 Ankyrin repeat-containing protein [Cynara cardunculus var. scolymus] Length = 663 Score = 84.0 bits (206), Expect = 1e-16 Identities = 41/67 (61%), Positives = 49/67 (73%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+ +DV++YAHSP HKAVVTKDY L+KIIAGLP+LCDP+ AKADAIS Sbjct: 1 MAAIDVTKYAHSPTHKAVVTKDYGGLKKIIAGLPRLCDPSEIHNESVSLAEEAKADAISA 60 Query: 314 VIDCRNV 334 VID R+V Sbjct: 61 VIDRRDV 67 >XP_011034459.1 PREDICTED: ankyrin repeat domain-containing protein 13C-A-like [Populus euphratica] Length = 651 Score = 83.6 bits (205), Expect = 2e-16 Identities = 39/67 (58%), Positives = 49/67 (73%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+G+D+S+YAHSPVHKA+ KDYA LRKI+AGLP+LC+PA KADAI+T Sbjct: 1 MAGIDISKYAHSPVHKAIAAKDYATLRKIVAGLPRLCNPAEIRNEAISLAEEEKADAIAT 60 Query: 314 VIDCRNV 334 ID R+V Sbjct: 61 AIDRRDV 67 >AGA61019.1 hypothetical protein, partial [Erythranthe geyeri] Length = 113 Score = 78.2 bits (191), Expect = 2e-16 Identities = 38/67 (56%), Positives = 46/67 (68%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 MS +DVS+Y HSPVHKA++ KDYA LRKIIA LP+LCDP+ AKAD I+ Sbjct: 1 MSSVDVSKYEHSPVHKAIILKDYAGLRKIIASLPRLCDPSEIHTESVSLAEEAKADIIAA 60 Query: 314 VIDCRNV 334 ID R+V Sbjct: 61 AIDRRDV 67 >XP_002299280.2 hypothetical protein POPTR_0001s14330g, partial [Populus trichocarpa] EEE84085.2 hypothetical protein POPTR_0001s14330g, partial [Populus trichocarpa] Length = 538 Score = 83.2 bits (204), Expect = 2e-16 Identities = 39/67 (58%), Positives = 49/67 (73%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+G+D+S+YAHSPVHKA+ KDYA LRKI+AGLP+LC+PA KADAI+T Sbjct: 1 MAGIDISKYAHSPVHKAIAAKDYATLRKILAGLPRLCNPAEIRNEAISLAEEEKADAIAT 60 Query: 314 VIDCRNV 334 ID R+V Sbjct: 61 AIDRRDV 67 >XP_002518131.1 PREDICTED: ankyrin repeat domain-containing protein 13C [Ricinus communis] XP_015574096.1 PREDICTED: ankyrin repeat domain-containing protein 13C [Ricinus communis] XP_015574097.1 PREDICTED: ankyrin repeat domain-containing protein 13C [Ricinus communis] EEF44264.1 protein binding protein, putative [Ricinus communis] Length = 652 Score = 82.8 bits (203), Expect = 3e-16 Identities = 38/67 (56%), Positives = 50/67 (74%) Frame = +2 Query: 134 MSGLDVSEYAHSPVHKAVVTKDYAALRKIIAGLPQLCDPAXXXXXXXXXXXXAKADAIST 313 M+G+D+S+YAHSPVHKA+ T+D+A+LRKI+A LP+LCDPA KADAIS Sbjct: 1 MAGIDISKYAHSPVHKAIATRDFASLRKILAALPRLCDPAEIRTEAVSMAEEEKADAISA 60 Query: 314 VIDCRNV 334 V+D R+V Sbjct: 61 VVDRRDV 67