BLASTX nr result
ID: Angelica27_contig00011611
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00011611 (259 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017215697.1 PREDICTED: stress-associated endoplasmic reticulu... 81 2e-18 XP_017223203.1 PREDICTED: stress-associated endoplasmic reticulu... 80 3e-18 OMO60512.1 Endoplasmic reticulum, stress-associated Ramp4 [Corch... 76 2e-16 XP_008389884.1 PREDICTED: stress-associated endoplasmic reticulu... 75 5e-16 XP_004310090.1 PREDICTED: stress-associated endoplasmic reticulu... 75 5e-16 OAY34297.1 hypothetical protein MANES_12G009900 [Manihot esculenta] 74 1e-15 XP_016563777.1 PREDICTED: stress-associated endoplasmic reticulu... 74 1e-15 XP_010250694.1 PREDICTED: stress-associated endoplasmic reticulu... 74 1e-15 XP_004239223.1 PREDICTED: stress-associated endoplasmic reticulu... 74 1e-15 XP_006352178.1 PREDICTED: stress-associated endoplasmic reticulu... 74 1e-15 CDP13351.1 unnamed protein product [Coffea canephora] 75 1e-15 CDX84929.1 BnaC05g21260D [Brassica napus] 75 1e-15 XP_009797098.1 PREDICTED: stress-associated endoplasmic reticulu... 74 1e-15 XP_009626182.1 PREDICTED: stress-associated endoplasmic reticulu... 74 1e-15 XP_007223937.1 hypothetical protein PRUPE_ppa014280mg [Prunus pe... 74 1e-15 XP_019057342.1 PREDICTED: stress-associated endoplasmic reticulu... 74 1e-15 XP_007223936.1 hypothetical protein PRUPE_ppa014280mg [Prunus pe... 74 2e-15 XP_019058183.1 PREDICTED: stress-associated endoplasmic reticulu... 73 2e-15 XP_018846322.1 PREDICTED: stress-associated endoplasmic reticulu... 73 2e-15 OAY32337.1 hypothetical protein MANES_13G010600 [Manihot esculenta] 73 2e-15 >XP_017215697.1 PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Daucus carota subsp. sativus] Length = 68 Score = 80.9 bits (198), Expect = 2e-18 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TSKRLAD+KVQRFQKNITKRGAVPETVSKKGE YPVGPILL Sbjct: 3 TSKRLADKKVQRFQKNITKRGAVPETVSKKGEKYPVGPILL 43 >XP_017223203.1 PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Daucus carota subsp. sativus] Length = 68 Score = 80.5 bits (197), Expect = 3e-18 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TSKRL+DRKVQRFQKNITKRGAVPETVSKKG NYPVGPILL Sbjct: 3 TSKRLSDRKVQRFQKNITKRGAVPETVSKKGGNYPVGPILL 43 >OMO60512.1 Endoplasmic reticulum, stress-associated Ramp4 [Corchorus capsularis] OMO88126.1 Endoplasmic reticulum, stress-associated Ramp4 [Corchorus olitorius] Length = 70 Score = 75.9 bits (185), Expect = 2e-16 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +2 Query: 86 LEAMTSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 ++ TS+RLADRKV+RF+KNITKRGAVPET +KKG NYPVGP+LL Sbjct: 1 MDPTTSRRLADRKVERFEKNITKRGAVPETSTKKGSNYPVGPVLL 45 >XP_008389884.1 PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Malus domestica] Length = 68 Score = 74.7 bits (182), Expect = 5e-16 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TS+RLADRKV+RF+KNITKRGAVPET +KKG++YPVGPILL Sbjct: 3 TSRRLADRKVERFEKNITKRGAVPETTAKKGKDYPVGPILL 43 >XP_004310090.1 PREDICTED: stress-associated endoplasmic reticulum protein 2 [Fragaria vesca subsp. vesca] Length = 68 Score = 74.7 bits (182), Expect = 5e-16 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TS+RLADRKV+RF+KNITKRGAVPET +KKG++YPVGPILL Sbjct: 3 TSRRLADRKVERFEKNITKRGAVPETTAKKGKDYPVGPILL 43 >OAY34297.1 hypothetical protein MANES_12G009900 [Manihot esculenta] Length = 68 Score = 73.9 bits (180), Expect = 1e-15 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TS+RLADRKV+RF+KNITKRGAVPET +KKG +YPVGP+LL Sbjct: 3 TSRRLADRKVERFEKNITKRGAVPETTTKKGNDYPVGPVLL 43 >XP_016563777.1 PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Capsicum annuum] Length = 68 Score = 73.9 bits (180), Expect = 1e-15 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TS+RLADRKV+RF+KNITKRGAVPET +KKG YPVGPILL Sbjct: 3 TSRRLADRKVERFEKNITKRGAVPETTAKKGNQYPVGPILL 43 >XP_010250694.1 PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Nelumbo nucifera] Length = 68 Score = 73.9 bits (180), Expect = 1e-15 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TS+RLAD+KV+RF+KNITKRGAVPET +KKG NYPVGPI+L Sbjct: 3 TSRRLADKKVERFEKNITKRGAVPETTTKKGSNYPVGPIVL 43 >XP_004239223.1 PREDICTED: stress-associated endoplasmic reticulum protein 2 [Solanum lycopersicum] XP_015061049.1 PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Solanum pennellii] Length = 68 Score = 73.9 bits (180), Expect = 1e-15 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TS+RLADRKV+RF+KNITKRGAVPET +KKG YPVGPILL Sbjct: 3 TSRRLADRKVERFEKNITKRGAVPETTAKKGSQYPVGPILL 43 >XP_006352178.1 PREDICTED: stress-associated endoplasmic reticulum protein 2 [Solanum tuberosum] Length = 69 Score = 73.9 bits (180), Expect = 1e-15 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TS+RLADRKV+RF+KNITKRGAVPET +KKG YPVGPILL Sbjct: 3 TSRRLADRKVERFEKNITKRGAVPETTAKKGSQYPVGPILL 43 >CDP13351.1 unnamed protein product [Coffea canephora] Length = 118 Score = 75.1 bits (183), Expect = 1e-15 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +2 Query: 80 NLLEAMTSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 N + TS+RLADRKV++F+KNIT+RGAVPET +KKG NYPVGPILL Sbjct: 47 NFVRQTTSRRLADRKVEKFEKNITRRGAVPETSTKKGSNYPVGPILL 93 >CDX84929.1 BnaC05g21260D [Brassica napus] Length = 105 Score = 74.7 bits (182), Expect = 1e-15 Identities = 36/56 (64%), Positives = 45/56 (80%) Frame = +2 Query: 53 PRFFFLAAQNLLEAMTSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 PR F L ++ + TSKRLADRK+++F KNITKRG VPET +KKG++YPVGPILL Sbjct: 28 PRVFLLRSKTMT---TSKRLADRKIEKFDKNITKRGFVPETTTKKGKDYPVGPILL 80 >XP_009797098.1 PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Nicotiana sylvestris] XP_016504994.1 PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Nicotiana tabacum] XP_019225178.1 PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Nicotiana attenuata] OIT32853.1 hypothetical protein A4A49_07213 [Nicotiana attenuata] Length = 68 Score = 73.6 bits (179), Expect = 1e-15 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TS+RLADRK++RF+KNITKRGAVPET +KKG YPVGPILL Sbjct: 3 TSRRLADRKIERFEKNITKRGAVPETTAKKGNQYPVGPILL 43 >XP_009626182.1 PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Nicotiana tomentosiformis] XP_016491546.1 PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Nicotiana tabacum] Length = 68 Score = 73.6 bits (179), Expect = 1e-15 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TS+RLADRK++RF+KNITKRGAVPET +KKG YPVGPILL Sbjct: 3 TSRRLADRKIERFEKNITKRGAVPETTAKKGNQYPVGPILL 43 >XP_007223937.1 hypothetical protein PRUPE_ppa014280mg [Prunus persica] XP_008222180.1 PREDICTED: stress-associated endoplasmic reticulum protein 2 [Prunus mume] ONI29956.1 hypothetical protein PRUPE_1G224500 [Prunus persica] Length = 68 Score = 73.6 bits (179), Expect = 1e-15 Identities = 33/41 (80%), Positives = 40/41 (97%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TS+RLADRKV++F+KNITKRGAVPET +KKG++YPVGPILL Sbjct: 3 TSRRLADRKVEKFEKNITKRGAVPETTAKKGKDYPVGPILL 43 >XP_019057342.1 PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Tarenaya hassleriana] Length = 70 Score = 73.6 bits (179), Expect = 1e-15 Identities = 33/41 (80%), Positives = 40/41 (97%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TS+RLADRKV++F+KNITKRGAVPET +KKG++YPVGPILL Sbjct: 3 TSRRLADRKVEKFEKNITKRGAVPETTTKKGKDYPVGPILL 43 >XP_007223936.1 hypothetical protein PRUPE_ppa014280mg [Prunus persica] ONI29957.1 hypothetical protein PRUPE_1G224500 [Prunus persica] Length = 76 Score = 73.6 bits (179), Expect = 2e-15 Identities = 33/41 (80%), Positives = 40/41 (97%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TS+RLADRKV++F+KNITKRGAVPET +KKG++YPVGPILL Sbjct: 3 TSRRLADRKVEKFEKNITKRGAVPETTAKKGKDYPVGPILL 43 >XP_019058183.1 PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Tarenaya hassleriana] Length = 68 Score = 73.2 bits (178), Expect = 2e-15 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TS+RLADRKV++F+KNITKRGAVPET +KKG +YPVGPILL Sbjct: 3 TSRRLADRKVEKFEKNITKRGAVPETTTKKGNDYPVGPILL 43 >XP_018846322.1 PREDICTED: stress-associated endoplasmic reticulum protein 2-like [Juglans regia] Length = 68 Score = 73.2 bits (178), Expect = 2e-15 Identities = 32/41 (78%), Positives = 40/41 (97%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TS+RLADRKV++F+KNITKRGAVPET +KKG++YPVGP+LL Sbjct: 3 TSRRLADRKVEKFEKNITKRGAVPETTTKKGKDYPVGPVLL 43 >OAY32337.1 hypothetical protein MANES_13G010600 [Manihot esculenta] Length = 68 Score = 73.2 bits (178), Expect = 2e-15 Identities = 32/41 (78%), Positives = 40/41 (97%) Frame = +2 Query: 98 TSKRLADRKVQRFQKNITKRGAVPETVSKKGENYPVGPILL 220 TS+RLADRKV++F+KNITKRGAVPET +KKG++YPVGP+LL Sbjct: 3 TSRRLADRKVEKFEKNITKRGAVPETTTKKGKDYPVGPVLL 43