BLASTX nr result
ID: Angelica27_contig00010928
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00010928 (627 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017229310.1 PREDICTED: multiple organellar RNA editing factor... 77 4e-13 >XP_017229310.1 PREDICTED: multiple organellar RNA editing factor 1, mitochondrial-like [Daucus carota subsp. sativus] XP_017229311.1 PREDICTED: multiple organellar RNA editing factor 1, mitochondrial-like [Daucus carota subsp. sativus] KZN09172.1 hypothetical protein DCAR_001828 [Daucus carota subsp. sativus] Length = 507 Score = 77.4 bits (189), Expect = 4e-13 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = +3 Query: 159 HYG-QSTPGSYGQGTVGAVPGQEKFANYGHNNPVHGRSQGFSQGEEINDLHEVQQ 320 +YG Q T GSYGQG G VP QEKF N GHNNPVHG SQ FS+GE++ND +VQQ Sbjct: 453 NYGRQGTTGSYGQGIGGDVPVQEKFPNSGHNNPVHGESQRFSEGEQMNDFQQVQQ 507