BLASTX nr result
ID: Angelica27_contig00008559
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00008559 (419 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017215269.1 PREDICTED: protein BPS1, chloroplastic-like [Dauc... 93 9e-20 XP_017251251.1 PREDICTED: UPF0496 protein 4-like [Daucus carota ... 58 4e-07 >XP_017215269.1 PREDICTED: protein BPS1, chloroplastic-like [Daucus carota subsp. sativus] KZM86306.1 hypothetical protein DCAR_023440 [Daucus carota subsp. sativus] Length = 345 Score = 92.8 bits (229), Expect = 9e-20 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -3 Query: 177 MFLIEKKSTFPSFSPFRTAGKRSPPIDYDSICTSFDESILRRLKPLA 37 MFL EKKSTFPSFSPF+TAGKR PPIDYDSICTSFDESILRRLKPLA Sbjct: 1 MFLTEKKSTFPSFSPFQTAGKRPPPIDYDSICTSFDESILRRLKPLA 47 >XP_017251251.1 PREDICTED: UPF0496 protein 4-like [Daucus carota subsp. sativus] KZN09908.1 hypothetical protein DCAR_002564 [Daucus carota subsp. sativus] Length = 342 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -3 Query: 177 MFLIEKKSTFPSFSPFRTAGKRSPPIDYDSICTSFDESILRRLKPLA 37 MFL EK S FPSFSPFR++ KRSP D+D I +FDE + RLK LA Sbjct: 1 MFLTEKNSPFPSFSPFRSSLKRSPLHDFDLIFRTFDEKLASRLKDLA 47