BLASTX nr result
ID: Angelica27_contig00007898
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00007898 (288 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AGQ20410.1 calcium dependent protein kinase 1 [Zingiber officinale] 60 4e-12 OAP19692.1 CPK10 [Arabidopsis thaliana] 56 3e-11 AAO42812.1 At1g18890 [Arabidopsis thaliana] 56 3e-11 KFK44036.1 hypothetical protein AALP_AA1G207300 [Arabis alpina] 56 3e-11 NP_564066.2 calcium-dependent protein kinase 1 [Arabidopsis thal... 56 3e-11 XP_010477091.1 PREDICTED: calcium-dependent protein kinase 10-li... 56 3e-11 XP_010459535.1 PREDICTED: calcium-dependent protein kinase 10 [C... 56 3e-11 BAF06620.2 Os01g0832300 [Oryza sativa Japonica Group] 63 7e-11 BAA04829.1 calcium-dependent protein kinase [Arabidopsis thaliana] 56 9e-11 ABQ18316.1 calcium-dependent protein kinase 2, partial [Panax gi... 63 1e-10 ABD83937.1 calcium-dependent protein kinase 2, partial [Panax gi... 63 1e-10 ABU49648.1 calcium-dependent protein kinase 2, partial [Panax gi... 62 2e-10 ABY40355.1 calcium-dependent protein kinase 2a, partial [Vitis a... 62 3e-10 ABY61771.1 calcium-dependent protein kinase 2c, partial [Eritric... 61 5e-10 ABY26653.1 calcium-dependent protein kinase 2, partial [Eritrich... 61 7e-10 ABD77409.1 calcium-dependent protein kinase, partial [Zingiber o... 63 8e-10 ABR00806.1 calcium-dependent protein kinase 2, partial [Panax gi... 60 1e-09 CAB46228.1 calcium dependent protein kinase, partial [Arachis hy... 63 2e-09 AQK99592.1 Calcium-dependent protein kinase 13 [Zea mays] 63 2e-09 AQK86586.1 Calcium-dependent protein kinase 13 [Zea mays] AQK865... 63 2e-09 >AGQ20410.1 calcium dependent protein kinase 1 [Zingiber officinale] Length = 542 Score = 60.1 bits (144), Expect(2) = 4e-12 Identities = 30/39 (76%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 +FSEIVGSPYY+A EVLKRNYGP IDIWSA V FI C Sbjct: 220 RFSEIVGSPYYMAPEVLKRNYGPGIDIWSAGVILFILLC 258 Score = 38.1 bits (87), Expect(2) = 4e-12 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +1 Query: 91 GVILYILLCGVPPFWA 138 GVIL+ILLCGVPPFWA Sbjct: 250 GVILFILLCGVPPFWA 265 >OAP19692.1 CPK10 [Arabidopsis thaliana] Length = 545 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 26/39 (66%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 KF+EIVGSPYY+A EVLKR+YGP +D+WSA V +I C Sbjct: 220 KFTEIVGSPYYMAPEVLKRDYGPGVDVWSAGVIIYILLC 258 Score = 38.9 bits (89), Expect(2) = 3e-11 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +1 Query: 91 GVILYILLCGVPPFWA 138 GVI+YILLCGVPPFWA Sbjct: 250 GVIIYILLCGVPPFWA 265 >AAO42812.1 At1g18890 [Arabidopsis thaliana] Length = 545 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 26/39 (66%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 KF+EIVGSPYY+A EVLKR+YGP +D+WSA V +I C Sbjct: 220 KFTEIVGSPYYMAPEVLKRDYGPGVDVWSAGVIIYILLC 258 Score = 38.9 bits (89), Expect(2) = 3e-11 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +1 Query: 91 GVILYILLCGVPPFWA 138 GVI+YILLCGVPPFWA Sbjct: 250 GVIIYILLCGVPPFWA 265 >KFK44036.1 hypothetical protein AALP_AA1G207300 [Arabis alpina] Length = 545 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 26/39 (66%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 KF+EIVGSPYY+A EVLKR+YGP +D+WSA V +I C Sbjct: 220 KFTEIVGSPYYMAPEVLKRDYGPGVDVWSAGVIIYILLC 258 Score = 38.9 bits (89), Expect(2) = 3e-11 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +1 Query: 91 GVILYILLCGVPPFWA 138 GVI+YILLCGVPPFWA Sbjct: 250 GVIIYILLCGVPPFWA 265 >NP_564066.2 calcium-dependent protein kinase 1 [Arabidopsis thaliana] Q9M9V8.1 RecName: Full=Calcium-dependent protein kinase 10; AltName: Full=Calcium-dependent protein kinase isoform CDPK1; Short=AtCDPK1 AAF27092.1 calcium-dependent protein kinase 1 [Arabidopsis thaliana] BAE99593.1 calcium-dependent protein kinase [Arabidopsis thaliana] AEE29777.1 calcium-dependent protein kinase 1 [Arabidopsis thaliana] Length = 545 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 26/39 (66%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 KF+EIVGSPYY+A EVLKR+YGP +D+WSA V +I C Sbjct: 220 KFTEIVGSPYYMAPEVLKRDYGPGVDVWSAGVIIYILLC 258 Score = 38.9 bits (89), Expect(2) = 3e-11 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +1 Query: 91 GVILYILLCGVPPFWA 138 GVI+YILLCGVPPFWA Sbjct: 250 GVIIYILLCGVPPFWA 265 >XP_010477091.1 PREDICTED: calcium-dependent protein kinase 10-like [Camelina sativa] Length = 543 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 26/39 (66%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 KF+EIVGSPYY+A EVLKR+YGP +D+WSA V +I C Sbjct: 218 KFTEIVGSPYYMAPEVLKRDYGPGVDVWSAGVIIYILLC 256 Score = 38.9 bits (89), Expect(2) = 3e-11 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +1 Query: 91 GVILYILLCGVPPFWA 138 GVI+YILLCGVPPFWA Sbjct: 248 GVIIYILLCGVPPFWA 263 >XP_010459535.1 PREDICTED: calcium-dependent protein kinase 10 [Camelina sativa] Length = 543 Score = 56.2 bits (134), Expect(2) = 3e-11 Identities = 26/39 (66%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 KF+EIVGSPYY+A EVLKR+YGP +D+WSA V +I C Sbjct: 218 KFTEIVGSPYYMAPEVLKRDYGPGVDVWSAGVIIYILLC 256 Score = 38.9 bits (89), Expect(2) = 3e-11 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +1 Query: 91 GVILYILLCGVPPFWA 138 GVI+YILLCGVPPFWA Sbjct: 248 GVIIYILLCGVPPFWA 263 >BAF06620.2 Os01g0832300 [Oryza sativa Japonica Group] Length = 96 Score = 62.8 bits (151), Expect = 7e-11 Identities = 31/39 (79%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 KFSEIVGSPYY+A EVLKRNYGPEIDIWSA V +I C Sbjct: 45 KFSEIVGSPYYMAPEVLKRNYGPEIDIWSAGVILYILLC 83 >BAA04829.1 calcium-dependent protein kinase [Arabidopsis thaliana] Length = 493 Score = 56.2 bits (134), Expect(2) = 9e-11 Identities = 26/39 (66%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 KF+EIVGSPYY+A EVLKR+YGP +D+WSA V +I C Sbjct: 168 KFTEIVGSPYYMAPEVLKRDYGPGVDVWSAGVIIYILLC 206 Score = 37.4 bits (85), Expect(2) = 9e-11 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 91 GVILYILLCGVPPFWA 138 GVI+YILLCG PPFWA Sbjct: 198 GVIIYILLCGAPPFWA 213 >ABQ18316.1 calcium-dependent protein kinase 2, partial [Panax ginseng] Length = 118 Score = 62.8 bits (151), Expect = 1e-10 Identities = 31/39 (79%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 KFSEIVGSPYY+A EVLKRNYGPEIDIWSA V +I C Sbjct: 78 KFSEIVGSPYYMAPEVLKRNYGPEIDIWSAGVILYILLC 116 >ABD83937.1 calcium-dependent protein kinase 2, partial [Panax ginseng] Length = 118 Score = 62.8 bits (151), Expect = 1e-10 Identities = 31/39 (79%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 KFSEIVGSPYY+A EVLKRNYGPEIDIWSA V +I C Sbjct: 78 KFSEIVGSPYYMAPEVLKRNYGPEIDIWSAGVILYILLC 116 >ABU49648.1 calcium-dependent protein kinase 2, partial [Panax ginseng] Length = 118 Score = 62.0 bits (149), Expect = 2e-10 Identities = 29/39 (74%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 KFSEIVGSPYY+A EVLKRNYGPE+D+WSA V +I C Sbjct: 78 KFSEIVGSPYYMAPEVLKRNYGPEVDVWSAGVILYILLC 116 >ABY40355.1 calcium-dependent protein kinase 2a, partial [Vitis amurensis] Length = 109 Score = 61.6 bits (148), Expect = 3e-10 Identities = 30/39 (76%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 +FSEIVGSPYY+A EVLKRNYGPEIDIWSA V +I C Sbjct: 69 RFSEIVGSPYYMAPEVLKRNYGPEIDIWSAGVILYILLC 107 >ABY61771.1 calcium-dependent protein kinase 2c, partial [Eritrichium sericeum] Length = 118 Score = 61.2 bits (147), Expect = 5e-10 Identities = 29/39 (74%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 +FSEIVGSPYY+A EVLKRNYGPE+DIWSA V +I C Sbjct: 78 RFSEIVGSPYYMAPEVLKRNYGPEVDIWSAGVILYILLC 116 >ABY26653.1 calcium-dependent protein kinase 2, partial [Eritrichium sericeum] Length = 118 Score = 60.8 bits (146), Expect = 7e-10 Identities = 30/38 (78%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = +2 Query: 5 FSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 FSEIVGSPYY+A EVLKRNYGPEIDIWSA V +I C Sbjct: 79 FSEIVGSPYYMAPEVLKRNYGPEIDIWSAGVILYILLC 116 >ABD77409.1 calcium-dependent protein kinase, partial [Zingiber officinale] Length = 232 Score = 62.8 bits (151), Expect = 8e-10 Identities = 31/39 (79%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 +FSEIVGSPYY+A EVLKRNYGPEIDIWSA V FI C Sbjct: 101 RFSEIVGSPYYMAPEVLKRNYGPEIDIWSAGVILFILLC 139 >ABR00806.1 calcium-dependent protein kinase 2, partial [Panax ginseng] Length = 118 Score = 60.1 bits (144), Expect = 1e-09 Identities = 28/39 (71%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 +F+EIVGSPYY+A EVLKRNYGPEID+WSA V +I C Sbjct: 78 RFNEIVGSPYYMAPEVLKRNYGPEIDVWSAGVILYILLC 116 >CAB46228.1 calcium dependent protein kinase, partial [Arachis hypogaea] Length = 318 Score = 62.8 bits (151), Expect = 2e-09 Identities = 31/39 (79%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 KFSEIVGSPYY+A EVLKRNYGPEIDIWSA V +I C Sbjct: 38 KFSEIVGSPYYMAPEVLKRNYGPEIDIWSAGVILYILLC 76 >AQK99592.1 Calcium-dependent protein kinase 13 [Zea mays] Length = 342 Score = 62.8 bits (151), Expect = 2e-09 Identities = 31/39 (79%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 KFSEIVGSPYY+A EVLKRNYGPEIDIWSA V +I C Sbjct: 24 KFSEIVGSPYYMAPEVLKRNYGPEIDIWSAGVILYILLC 62 >AQK86586.1 Calcium-dependent protein kinase 13 [Zea mays] AQK86588.1 Calcium-dependent protein kinase 13 [Zea mays] Length = 396 Score = 62.8 bits (151), Expect = 2e-09 Identities = 31/39 (79%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +2 Query: 2 KFSEIVGSPYYIAAEVLKRNYGPEIDIWSA-V*YFIFSC 115 KFSEIVGSPYY+A EVLKRNYGPEIDIWSA V +I C Sbjct: 223 KFSEIVGSPYYMAPEVLKRNYGPEIDIWSAGVILYILLC 261