BLASTX nr result
ID: Angelica27_contig00007775
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00007775 (302 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACA30282.1 putative elongation factor 1A, partial [Cupressus sem... 64 5e-11 BAV21604.1 elongation factor 1 alpha [Capsicum annuum] 62 7e-10 >ACA30282.1 putative elongation factor 1A, partial [Cupressus sempervirens] Length = 138 Score = 64.3 bits (155), Expect = 5e-11 Identities = 40/80 (50%), Positives = 44/80 (55%), Gaps = 5/80 (6%) Frame = -2 Query: 301 MRQTVAVGVIKAVEKKEPTGXXXXXXXXXXXXKLVDYP-----QGAGLLLFGASVSPRDK 137 MRQTVAVGVIK+VEKKEPTG LVD G L + +D Sbjct: 48 MRQTVAVGVIKSVEKKEPTGAKVTKAAAKKKRSLVDCAVEEARHGHLSWLCLSRPIAQDL 107 Query: 136 FGRCLVSVRMQTWVLDRRWH 77 RC V+ RMQTWVLDRRWH Sbjct: 108 LVRCSVARRMQTWVLDRRWH 127 >BAV21604.1 elongation factor 1 alpha [Capsicum annuum] Length = 181 Score = 62.4 bits (150), Expect = 7e-10 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = -1 Query: 302 HEADCCCWCHQGCREEGTHWCQGHQGCYKEEMKVSRLSSGSW 177 HEA+CCCWC Q C +EG +WCQGHQGC +E S +S S+ Sbjct: 111 HEANCCCWCCQECSQEGPNWCQGHQGCPEEGEANSAVSCWSF 152