BLASTX nr result
ID: Angelica27_contig00007774
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00007774 (416 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAV21604.1 elongation factor 1 alpha [Capsicum annuum] 62 2e-09 >BAV21604.1 elongation factor 1 alpha [Capsicum annuum] Length = 181 Score = 62.4 bits (150), Expect = 2e-09 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 10/50 (20%) Frame = -1 Query: 416 HEADCCCWCHQGCREEGSHWCQGHQGCCKE-EVN---------CFVLALS 297 HEA+CCCWC Q C +EG +WCQGHQGC +E E N CF+L+ S Sbjct: 111 HEANCCCWCCQECSQEGPNWCQGHQGCPEEGEANSAVSCWSFQCFLLSSS 160