BLASTX nr result
ID: Angelica27_contig00006751
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00006751 (585 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM83859.1 hypothetical protein DCAR_028719 [Daucus carota subsp... 52 4e-06 XP_010088831.1 hypothetical protein L484_020814 [Morus notabilis... 52 4e-06 XP_006451139.1 hypothetical protein CICLE_v10010340mg [Citrus cl... 52 8e-06 >KZM83859.1 hypothetical protein DCAR_028719 [Daucus carota subsp. sativus] Length = 63 Score = 52.4 bits (124), Expect = 4e-06 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = +3 Query: 117 LSSTRSLALPSIVFMFMATLQQHLSHAQGFAPAPTPNGPVSDGSAVDQG 263 + S RSLAL + FMFM +QQ + AQ F+PAP PVSDGSA+DQG Sbjct: 1 MKSMRSLALVILGFMFMMLVQQQVVQAQEFSPAP---APVSDGSAIDQG 46 >XP_010088831.1 hypothetical protein L484_020814 [Morus notabilis] EXB37028.1 hypothetical protein L484_020814 [Morus notabilis] Length = 65 Score = 52.4 bits (124), Expect = 4e-06 Identities = 25/50 (50%), Positives = 36/50 (72%) Frame = +3 Query: 114 MLSSTRSLALPSIVFMFMATLQQHLSHAQGFAPAPTPNGPVSDGSAVDQG 263 M ++ +S ALP I F+ +A + +LSH Q AP+P P GPV+DG+A+DQG Sbjct: 1 MNTAMKSFALPIIGFILLALM--NLSHGQDLAPSPAPQGPVNDGTALDQG 48 >XP_006451139.1 hypothetical protein CICLE_v10010340mg [Citrus clementina] ESR64379.1 hypothetical protein CICLE_v10010340mg [Citrus clementina] KDO50879.1 hypothetical protein CISIN_1g036245mg [Citrus sinensis] Length = 64 Score = 51.6 bits (122), Expect = 8e-06 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = +3 Query: 114 MLSSTRSLALPSIVFMFMATLQQHLSHAQGFAPAPTPNGPVSDGSAVDQG 263 M++S R ALP I FMFMA LQ L +AQ AP+P P P SDG+A+DQG Sbjct: 1 MMNSMRLYALPVIGFMFMAILQ--LGNAQNMAPSPAP-APSSDGTAIDQG 47