BLASTX nr result
ID: Angelica27_contig00006699
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00006699 (430 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017253603.1 PREDICTED: glutamate receptor 2.9-like [Daucus ca... 94 2e-19 KZM99487.1 hypothetical protein DCAR_013151 [Daucus carota subsp... 66 1e-11 >XP_017253603.1 PREDICTED: glutamate receptor 2.9-like [Daucus carota subsp. sativus] KZN11248.1 hypothetical protein DCAR_003904 [Daucus carota subsp. sativus] Length = 973 Score = 93.6 bits (231), Expect = 2e-19 Identities = 47/95 (49%), Positives = 61/95 (64%) Frame = -2 Query: 429 SARHKKFFPRIRGKNKGSGNAPKKNDNSESNASSPKEIPDHICRDKYCTIHRRDNYTTSD 250 S+RHK F R R K+KG+ +A +K D S SN SPKEIPD+ICRDKYCT+HRRD++ TS+ Sbjct: 30 SSRHKYSFFRKRDKSKGTSHAQEKQDKSGSNVPSPKEIPDYICRDKYCTVHRRDDFGTSN 89 Query: 249 HVPKVNNGTGHPSLYQGSGNNNPMMNPYVQRPPTY 145 VP +N GS + P MN +V P + Sbjct: 90 RVPNMN-------YCGGSNYSYPRMNSFVPPPQNH 117 >KZM99487.1 hypothetical protein DCAR_013151 [Daucus carota subsp. sativus] Length = 94 Score = 66.2 bits (160), Expect = 1e-11 Identities = 36/71 (50%), Positives = 44/71 (61%), Gaps = 1/71 (1%) Frame = -2 Query: 324 KEIPDHICRDKYCTIHRRDNYTTSDHVPKVNNGTGHPSLYQGSGN-NNPMMNPYVQRPPT 148 KE+PD IC DKYCT+H RDNY P +N G G+P L++G N N P M+ +V PP Sbjct: 34 KEVPDDICNDKYCTLHSRDNYQ-----PNMNYGAGYPPLFRGGLNYNYPPMSSFV--PP- 85 Query: 147 YAPPPLHYQGQ 115 PPPL GQ Sbjct: 86 --PPPLPPYGQ 94