BLASTX nr result
ID: Angelica27_contig00006494
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00006494 (270 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN03067.1 hypothetical protein DCAR_011823 [Daucus carota subsp... 72 9e-13 XP_017242855.1 PREDICTED: anaphase-promoting complex subunit 1 i... 72 9e-13 XP_017242854.1 PREDICTED: anaphase-promoting complex subunit 1 i... 72 9e-13 >KZN03067.1 hypothetical protein DCAR_011823 [Daucus carota subsp. sativus] Length = 1700 Score = 72.0 bits (175), Expect = 9e-13 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -2 Query: 269 KLQPMRSGGTSSCSVPLLHLLFPKTPIQAITDIDKFCFS 153 KL+P+R GGTSSCSVPLLHLLFP+T IQA+ DIDKFCFS Sbjct: 1662 KLRPLRLGGTSSCSVPLLHLLFPRTHIQAVADIDKFCFS 1700 >XP_017242855.1 PREDICTED: anaphase-promoting complex subunit 1 isoform X2 [Daucus carota subsp. sativus] Length = 1799 Score = 72.0 bits (175), Expect = 9e-13 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -2 Query: 269 KLQPMRSGGTSSCSVPLLHLLFPKTPIQAITDIDKFCFS 153 KL+P+R GGTSSCSVPLLHLLFP+T IQA+ DIDKFCFS Sbjct: 1761 KLRPLRLGGTSSCSVPLLHLLFPRTHIQAVADIDKFCFS 1799 >XP_017242854.1 PREDICTED: anaphase-promoting complex subunit 1 isoform X1 [Daucus carota subsp. sativus] Length = 1811 Score = 72.0 bits (175), Expect = 9e-13 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -2 Query: 269 KLQPMRSGGTSSCSVPLLHLLFPKTPIQAITDIDKFCFS 153 KL+P+R GGTSSCSVPLLHLLFP+T IQA+ DIDKFCFS Sbjct: 1773 KLRPLRLGGTSSCSVPLLHLLFPRTHIQAVADIDKFCFS 1811