BLASTX nr result
ID: Angelica27_contig00006394
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00006394 (223 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONK72882.1 uncharacterized protein A4U43_C04F24380, partial [Asp... 91 5e-22 ONK77380.1 uncharacterized protein A4U43_C02F5930 [Asparagus off... 94 1e-20 XP_017241308.1 PREDICTED: cleft lip and palate transmembrane pro... 92 3e-20 KZN00865.1 hypothetical protein DCAR_009619 [Daucus carota subsp... 92 3e-20 XP_002518011.1 PREDICTED: cleft lip and palate transmembrane pro... 91 8e-20 XP_006836886.1 PREDICTED: cleft lip and palate transmembrane pro... 91 8e-20 KJB46901.1 hypothetical protein B456_008G001400 [Gossypium raimo... 91 1e-19 XP_017637916.1 PREDICTED: cleft lip and palate transmembrane pro... 91 1e-19 OAY35206.1 hypothetical protein MANES_12G081000 [Manihot esculenta] 91 1e-19 XP_016726065.1 PREDICTED: CLPTM1-like membrane protein cnrB [Gos... 91 1e-19 XP_012435796.1 PREDICTED: cleft lip and palate transmembrane pro... 91 1e-19 XP_017637915.1 PREDICTED: cleft lip and palate transmembrane pro... 91 1e-19 XP_012435795.1 PREDICTED: cleft lip and palate transmembrane pro... 91 1e-19 KHG08136.1 Cleft lip and palate transmembrane 1 [Gossypium arbor... 91 1e-19 XP_016718644.1 PREDICTED: cleft lip and palate transmembrane pro... 91 1e-19 XP_016717988.1 PREDICTED: cleft lip and palate transmembrane pro... 91 1e-19 XP_012459076.1 PREDICTED: CLPTM1-like membrane protein cnrB [Gos... 91 1e-19 XP_006466213.1 PREDICTED: cleft lip and palate transmembrane pro... 91 1e-19 XP_006426404.1 hypothetical protein CICLE_v10025224mg [Citrus cl... 91 1e-19 XP_012435794.1 PREDICTED: cleft lip and palate transmembrane pro... 91 1e-19 >ONK72882.1 uncharacterized protein A4U43_C04F24380, partial [Asparagus officinalis] Length = 106 Score = 90.5 bits (223), Expect = 5e-22 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL++ MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 12 RVFLEGNPYLLVVTMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 62 >ONK77380.1 uncharacterized protein A4U43_C02F5930 [Asparagus officinalis] Length = 589 Score = 93.6 bits (231), Expect = 1e-20 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL++ MVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLS KSVV Sbjct: 309 RVFLEGNPYLLVVTMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSAKSVV 359 >XP_017241308.1 PREDICTED: cleft lip and palate transmembrane protein 1 homolog [Daucus carota subsp. sativus] Length = 595 Score = 92.4 bits (228), Expect = 3e-20 Identities = 47/51 (92%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLLMI MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 321 RVFLEGNPYLLMITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 371 >KZN00865.1 hypothetical protein DCAR_009619 [Daucus carota subsp. sativus] Length = 621 Score = 92.4 bits (228), Expect = 3e-20 Identities = 47/51 (92%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLLMI MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 313 RVFLEGNPYLLMITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 363 >XP_002518011.1 PREDICTED: cleft lip and palate transmembrane protein 1 homolog [Ricinus communis] EEF44529.1 Cleft lip and palate transmembrane protein, putative [Ricinus communis] Length = 578 Score = 91.3 bits (225), Expect = 8e-20 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 309 RVFLEGNPYLLLITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 359 >XP_006836886.1 PREDICTED: cleft lip and palate transmembrane protein 1 homolog [Amborella trichopoda] ERM99739.1 hypothetical protein AMTR_s00099p00111060 [Amborella trichopoda] Length = 594 Score = 91.3 bits (225), Expect = 8e-20 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 317 RVFLEGNPYLLLITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 367 >KJB46901.1 hypothetical protein B456_008G001400 [Gossypium raimondii] Length = 495 Score = 90.9 bits (224), Expect = 1e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 317 RVFLEGNPYLLVITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 367 >XP_017637916.1 PREDICTED: cleft lip and palate transmembrane protein 1 homolog isoform X3 [Gossypium arboreum] Length = 556 Score = 90.9 bits (224), Expect = 1e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 326 RVFLEGNPYLLVITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 376 >OAY35206.1 hypothetical protein MANES_12G081000 [Manihot esculenta] Length = 583 Score = 90.9 bits (224), Expect = 1e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 311 RVFLEGNPYLLVITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 361 >XP_016726065.1 PREDICTED: CLPTM1-like membrane protein cnrB [Gossypium hirsutum] Length = 587 Score = 90.9 bits (224), Expect = 1e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 314 RVFLEGNPYLLVITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 364 >XP_012435796.1 PREDICTED: cleft lip and palate transmembrane protein 1 homolog isoform X3 [Gossypium raimondii] KJB46898.1 hypothetical protein B456_008G001400 [Gossypium raimondii] KJB46902.1 hypothetical protein B456_008G001400 [Gossypium raimondii] KJB46903.1 hypothetical protein B456_008G001400 [Gossypium raimondii] Length = 587 Score = 90.9 bits (224), Expect = 1e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 317 RVFLEGNPYLLVITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 367 >XP_017637915.1 PREDICTED: cleft lip and palate transmembrane protein 1 homolog isoform X2 [Gossypium arboreum] Length = 589 Score = 90.9 bits (224), Expect = 1e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 319 RVFLEGNPYLLVITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 369 >XP_012435795.1 PREDICTED: cleft lip and palate transmembrane protein 1 homolog isoform X2 [Gossypium raimondii] Length = 589 Score = 90.9 bits (224), Expect = 1e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 319 RVFLEGNPYLLVITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 369 >KHG08136.1 Cleft lip and palate transmembrane 1 [Gossypium arboreum] Length = 589 Score = 90.9 bits (224), Expect = 1e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 319 RVFLEGNPYLLVITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 369 >XP_016718644.1 PREDICTED: cleft lip and palate transmembrane protein 1 homolog isoform X2 [Gossypium hirsutum] Length = 590 Score = 90.9 bits (224), Expect = 1e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 320 RVFLEGNPYLLVITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 370 >XP_016717988.1 PREDICTED: cleft lip and palate transmembrane protein 1 homolog isoform X1 [Gossypium hirsutum] Length = 590 Score = 90.9 bits (224), Expect = 1e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 320 RVFLEGNPYLLVITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 370 >XP_012459076.1 PREDICTED: CLPTM1-like membrane protein cnrB [Gossypium raimondii] KJB75531.1 hypothetical protein B456_012G045800 [Gossypium raimondii] Length = 590 Score = 90.9 bits (224), Expect = 1e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 317 RVFLEGNPYLLVITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 367 >XP_006466213.1 PREDICTED: cleft lip and palate transmembrane protein 1 homolog [Citrus sinensis] Length = 592 Score = 90.9 bits (224), Expect = 1e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 318 RVFLEGNPYLLVITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 368 >XP_006426404.1 hypothetical protein CICLE_v10025224mg [Citrus clementina] ESR39644.1 hypothetical protein CICLE_v10025224mg [Citrus clementina] KDO58748.1 hypothetical protein CISIN_1g007700mg [Citrus sinensis] Length = 592 Score = 90.9 bits (224), Expect = 1e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 318 RVFLEGNPYLLVITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 368 >XP_012435794.1 PREDICTED: cleft lip and palate transmembrane protein 1 homolog isoform X1 [Gossypium raimondii] KJB46899.1 hypothetical protein B456_008G001400 [Gossypium raimondii] Length = 594 Score = 90.9 bits (224), Expect = 1e-19 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 71 RVFLESNPYLLMIMMVVSLLHSVFDFLAFKNDIQFRNKNKSMEGLSEKSVV 223 RVFLE NPYLL+I MVVSLLHSVFDFLAFKNDIQF NKNKSMEGLS KSVV Sbjct: 324 RVFLEGNPYLLVITMVVSLLHSVFDFLAFKNDIQFWNKNKSMEGLSAKSVV 374