BLASTX nr result
ID: Angelica27_contig00006249
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00006249 (409 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017229233.1 PREDICTED: ycf20-like protein isoform X2 [Daucus ... 87 3e-18 XP_017229232.1 PREDICTED: ycf20-like protein isoform X1 [Daucus ... 87 3e-18 KZN09489.1 hypothetical protein DCAR_002145 [Daucus carota subsp... 78 4e-14 >XP_017229233.1 PREDICTED: ycf20-like protein isoform X2 [Daucus carota subsp. sativus] Length = 226 Score = 86.7 bits (213), Expect = 3e-18 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = +3 Query: 258 SIEPVMLHVSLPLKGNKIPQASFLIVRHCNTVLNCNKKQIYRCVSRPAS 404 SIEP+MLH+SLP+KG +IPQASFLI+RHC TVLN NKKQIYRCV+RPAS Sbjct: 18 SIEPIMLHLSLPIKGIEIPQASFLILRHCITVLNWNKKQIYRCVNRPAS 66 >XP_017229232.1 PREDICTED: ycf20-like protein isoform X1 [Daucus carota subsp. sativus] Length = 237 Score = 86.7 bits (213), Expect = 3e-18 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = +3 Query: 258 SIEPVMLHVSLPLKGNKIPQASFLIVRHCNTVLNCNKKQIYRCVSRPAS 404 SIEP+MLH+SLP+KG +IPQASFLI+RHC TVLN NKKQIYRCV+RPAS Sbjct: 29 SIEPIMLHLSLPIKGIEIPQASFLILRHCITVLNWNKKQIYRCVNRPAS 77 >KZN09489.1 hypothetical protein DCAR_002145 [Daucus carota subsp. sativus] Length = 579 Score = 77.8 bits (190), Expect = 4e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 273 MLHVSLPLKGNKIPQASFLIVRHCNTVLNCNKKQIYRCVSRPAS 404 MLH+SLP+KG +IPQASFLI+RHC TVLN NKKQIYRCV+RPAS Sbjct: 1 MLHLSLPIKGIEIPQASFLILRHCITVLNWNKKQIYRCVNRPAS 44