BLASTX nr result
ID: Angelica27_contig00004848
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00004848 (400 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017226514.1 PREDICTED: stem-specific protein TSJT1-like [Dauc... 61 2e-08 XP_017255374.1 PREDICTED: stem-specific protein TSJT1-like [Dauc... 59 1e-07 >XP_017226514.1 PREDICTED: stem-specific protein TSJT1-like [Daucus carota subsp. sativus] KZN11430.1 hypothetical protein DCAR_004086 [Daucus carota subsp. sativus] Length = 262 Score = 60.8 bits (146), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 FKVDVYSKTKTSMPRVGSEANWADIWGQQA 91 FKVDVYSKTK+SMPRVGSEANWA +WGQ+A Sbjct: 233 FKVDVYSKTKSSMPRVGSEANWAAVWGQEA 262 >XP_017255374.1 PREDICTED: stem-specific protein TSJT1-like [Daucus carota subsp. sativus] KZN11453.1 hypothetical protein DCAR_004109 [Daucus carota subsp. sativus] Length = 264 Score = 58.5 bits (140), Expect = 1e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +2 Query: 2 FKVDVYSKTKTSMPRVGSEANWADIWGQQA*H 97 FKVDVYSKTK SMPRVGSEANWA +WGQQA H Sbjct: 233 FKVDVYSKTK-SMPRVGSEANWAAVWGQQAEH 263