BLASTX nr result
ID: Angelica27_contig00004719
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00004719 (251 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM87097.1 hypothetical protein DCAR_024231 [Daucus carota subsp... 63 2e-11 XP_002314644.1 hypothetical protein POPTR_0010s08610g [Populus t... 53 2e-07 XP_006387620.1 hypothetical protein POPTR_0770s00230g [Populus t... 53 2e-07 KMT10312.1 hypothetical protein BVRB_5g120630 [Beta vulgaris sub... 51 4e-07 XP_002314193.1 hypothetical protein POPTR_0009s03360g [Populus t... 51 8e-07 XP_010932900.1 PREDICTED: glu S.griseus protease inhibitor-like ... 51 1e-06 KOM35544.1 hypothetical protein LR48_Vigan02g169400 [Vigna angul... 51 1e-06 XP_006378353.1 hypothetical protein POPTR_0010s08630g [Populus t... 51 1e-06 >KZM87097.1 hypothetical protein DCAR_024231 [Daucus carota subsp. sativus] Length = 69 Score = 63.2 bits (152), Expect = 2e-11 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -3 Query: 249 VQEGSSVIENFSCERVWVWVNCDGIVISTPQIG 151 V+EG+SVI+NFSCERVWVWVNCD +V+S P+IG Sbjct: 37 VKEGTSVIDNFSCERVWVWVNCDNVVVSIPKIG 69 >XP_002314644.1 hypothetical protein POPTR_0010s08610g [Populus trichocarpa] XP_006387618.1 hypothetical protein POPTR_0770s00210g [Populus trichocarpa] EEF00815.1 hypothetical protein POPTR_0010s08610g [Populus trichocarpa] ERP46532.1 hypothetical protein POPTR_0770s00210g [Populus trichocarpa] Length = 70 Score = 52.8 bits (125), Expect = 2e-07 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -3 Query: 249 VQEGSSVIENFSCERVWVWVNCDGIVISTPQIG 151 V EGSS+IENF C+RVWVWV+ DGIV P IG Sbjct: 38 VPEGSSIIENFRCDRVWVWVDKDGIVYIVPVIG 70 >XP_006387620.1 hypothetical protein POPTR_0770s00230g [Populus trichocarpa] ERP46534.1 hypothetical protein POPTR_0770s00230g [Populus trichocarpa] Length = 70 Score = 52.8 bits (125), Expect = 2e-07 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -3 Query: 249 VQEGSSVIENFSCERVWVWVNCDGIVISTPQIG 151 V EGSS+IENF C+RVWVWV+ DGIV P IG Sbjct: 38 VPEGSSIIENFRCDRVWVWVDKDGIVYIVPVIG 70 >KMT10312.1 hypothetical protein BVRB_5g120630 [Beta vulgaris subsp. vulgaris] Length = 40 Score = 51.2 bits (121), Expect = 4e-07 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = -3 Query: 246 QEGSSVIENFSCERVWVWVNCDGIVISTPQIG 151 Q G+ VI NFSC RVWVWV+C+GIV+ P IG Sbjct: 9 QIGTPVILNFSCNRVWVWVDCEGIVVRPPMIG 40 >XP_002314193.1 hypothetical protein POPTR_0009s03360g [Populus trichocarpa] EEE88148.1 hypothetical protein POPTR_0009s03360g [Populus trichocarpa] Length = 70 Score = 51.2 bits (121), Expect = 8e-07 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -3 Query: 249 VQEGSSVIENFSCERVWVWVNCDGIVISTPQIG 151 V EGSS+IE+F C+RVWVWV+ DGIV P IG Sbjct: 38 VPEGSSIIEDFRCDRVWVWVDKDGIVYLVPAIG 70 >XP_010932900.1 PREDICTED: glu S.griseus protease inhibitor-like [Elaeis guineensis] Length = 68 Score = 50.8 bits (120), Expect = 1e-06 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = -3 Query: 249 VQEGSSVIENFSCERVWVWVNCDGIVISTPQIG 151 V G SV+ NFSCERVWVWV+ DGIV P+IG Sbjct: 36 VMVGESVVLNFSCERVWVWVDKDGIVAQVPKIG 68 >KOM35544.1 hypothetical protein LR48_Vigan02g169400 [Vigna angularis] BAT94762.1 hypothetical protein VIGAN_08139400 [Vigna angularis var. angularis] Length = 69 Score = 50.8 bits (120), Expect = 1e-06 Identities = 21/33 (63%), Positives = 24/33 (72%) Frame = -3 Query: 249 VQEGSSVIENFSCERVWVWVNCDGIVISTPQIG 151 V EGSSVI NF C+RVWVW+N +G V P IG Sbjct: 37 VPEGSSVIANFQCDRVWVWINKEGFVYQVPTIG 69 >XP_006378353.1 hypothetical protein POPTR_0010s08630g [Populus trichocarpa] ERP56150.1 hypothetical protein POPTR_0010s08630g [Populus trichocarpa] Length = 70 Score = 50.8 bits (120), Expect = 1e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -3 Query: 249 VQEGSSVIENFSCERVWVWVNCDGIVISTPQIG 151 V EGSSVI NF C+RVWVWV+ DGIV P IG Sbjct: 38 VPEGSSVIMNFQCDRVWVWVDKDGIVYIVPVIG 70