BLASTX nr result
ID: Angelica27_contig00004550
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00004550 (227 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM80901.1 hypothetical protein DCAR_031485 [Daucus carota subsp... 70 1e-13 XP_017227554.1 PREDICTED: UPF0235 protein LHK_03181 [Daucus caro... 70 1e-13 KDP26124.1 hypothetical protein JCGZ_22225 [Jatropha curcas] 60 8e-10 XP_018813900.1 PREDICTED: UPF0235 protein C15orf40 homolog [Jugl... 60 9e-10 XP_008460904.1 PREDICTED: UPF0235 protein LHK_03181 [Cucumis melo] 60 1e-09 OMO84694.1 hypothetical protein COLO4_21895 [Corchorus olitorius] 60 1e-09 OMO57080.1 hypothetical protein CCACVL1_26021 [Corchorus capsula... 60 1e-09 XP_012086065.1 PREDICTED: UPF0235 protein C15orf40 homolog isofo... 60 1e-09 XP_012086064.1 PREDICTED: UPF0235 protein C15orf40 homolog isofo... 60 1e-09 XP_007048278.2 PREDICTED: UPF0235 protein C15orf40 homolog [Theo... 59 2e-09 XP_011099784.1 PREDICTED: UPF0235 protein C15orf40 homolog [Sesa... 59 2e-09 EOX92435.1 UPF0235 protein C15orf40 [Theobroma cacao] 59 2e-09 XP_012460630.1 PREDICTED: UPF0235 protein C15orf40 homolog [Goss... 59 2e-09 XP_008245124.1 PREDICTED: UPF0235 protein C15orf40-like [Prunus ... 59 2e-09 XP_007221212.1 hypothetical protein PRUPE_ppa013315mg [Prunus pe... 59 2e-09 XP_006382826.1 hypothetical protein POPTR_0005s05820g [Populus t... 59 2e-09 XP_015869785.1 PREDICTED: UPF0235 protein C15orf40 homolog isofo... 59 2e-09 XP_015869096.1 PREDICTED: UPF0235 protein C15orf40 homolog isofo... 59 2e-09 XP_015869784.1 PREDICTED: UPF0235 protein C15orf40 homolog isofo... 59 2e-09 XP_015869095.1 PREDICTED: UPF0235 protein C15orf40 homolog isofo... 59 2e-09 >KZM80901.1 hypothetical protein DCAR_031485 [Daucus carota subsp. sativus] Length = 125 Score = 69.7 bits (169), Expect = 1e-13 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDNDFKAR 121 VKRRQ+SIGSGSKSRGKLVLVEEVTLQ VFDALD FKAR Sbjct: 86 VKRRQLSIGSGSKSRGKLVLVEEVTLQGVFDALDKCFKAR 125 >XP_017227554.1 PREDICTED: UPF0235 protein LHK_03181 [Daucus carota subsp. sativus] XP_017227555.1 PREDICTED: UPF0235 protein LHK_03181 [Daucus carota subsp. sativus] Length = 128 Score = 69.7 bits (169), Expect = 1e-13 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDNDFKAR 121 VKRRQ+SIGSGSKSRGKLVLVEEVTLQ VFDALD FKAR Sbjct: 89 VKRRQLSIGSGSKSRGKLVLVEEVTLQGVFDALDKCFKAR 128 >KDP26124.1 hypothetical protein JCGZ_22225 [Jatropha curcas] Length = 131 Score = 60.1 bits (144), Expect = 8e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALD 103 VKRRQVSIGSGSKSR K+V+VEEVTLQ+VFDALD Sbjct: 92 VKRRQVSIGSGSKSRDKVVIVEEVTLQNVFDALD 125 >XP_018813900.1 PREDICTED: UPF0235 protein C15orf40 homolog [Juglans regia] Length = 132 Score = 60.1 bits (144), Expect = 9e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDN 106 VKRRQVSIGSGSKSR K+V+VEEVT+Q+VFD LDN Sbjct: 94 VKRRQVSIGSGSKSRDKVVIVEEVTIQNVFDTLDN 128 >XP_008460904.1 PREDICTED: UPF0235 protein LHK_03181 [Cucumis melo] Length = 156 Score = 60.5 bits (145), Expect = 1e-09 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALD 103 VKRRQVSIGSGSKSRGK+V+VEEV+LQSVFDAL+ Sbjct: 117 VKRRQVSIGSGSKSRGKVVIVEEVSLQSVFDALN 150 >OMO84694.1 hypothetical protein COLO4_21895 [Corchorus olitorius] Length = 127 Score = 59.7 bits (143), Expect = 1e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDNDFKA 118 VKRRQVSIGSGSKSR K+V+VEE+TLQSVFDAL+ K+ Sbjct: 89 VKRRQVSIGSGSKSRDKVVIVEEITLQSVFDALNKASKS 127 >OMO57080.1 hypothetical protein CCACVL1_26021 [Corchorus capsularis] Length = 127 Score = 59.7 bits (143), Expect = 1e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDNDFKA 118 VKRRQVSIGSGSKSR K+V+VEE+TLQSVFDAL+ K+ Sbjct: 89 VKRRQVSIGSGSKSRDKVVIVEEITLQSVFDALNKASKS 127 >XP_012086065.1 PREDICTED: UPF0235 protein C15orf40 homolog isoform X2 [Jatropha curcas] Length = 144 Score = 60.1 bits (144), Expect = 1e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALD 103 VKRRQVSIGSGSKSR K+V+VEEVTLQ+VFDALD Sbjct: 105 VKRRQVSIGSGSKSRDKVVIVEEVTLQNVFDALD 138 >XP_012086064.1 PREDICTED: UPF0235 protein C15orf40 homolog isoform X1 [Jatropha curcas] Length = 153 Score = 60.1 bits (144), Expect = 1e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALD 103 VKRRQVSIGSGSKSR K+V+VEEVTLQ+VFDALD Sbjct: 114 VKRRQVSIGSGSKSRDKVVIVEEVTLQNVFDALD 147 >XP_007048278.2 PREDICTED: UPF0235 protein C15orf40 homolog [Theobroma cacao] Length = 126 Score = 59.3 bits (142), Expect = 2e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDNDFK 115 VKRRQVSIGSGSKSR K+V+VEE+TLQSVFDAL+ K Sbjct: 88 VKRRQVSIGSGSKSRDKVVIVEEITLQSVFDALNKASK 125 >XP_011099784.1 PREDICTED: UPF0235 protein C15orf40 homolog [Sesamum indicum] Length = 126 Score = 59.3 bits (142), Expect = 2e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDNDFK 115 VK+RQVSIGSGSKSR K+V+VEEVTLQ VFDALD K Sbjct: 87 VKKRQVSIGSGSKSRDKVVIVEEVTLQGVFDALDKVLK 124 >EOX92435.1 UPF0235 protein C15orf40 [Theobroma cacao] Length = 126 Score = 59.3 bits (142), Expect = 2e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDNDFK 115 VKRRQVSIGSGSKSR K+V+VEE+TLQSVFDAL+ K Sbjct: 88 VKRRQVSIGSGSKSRDKVVIVEEITLQSVFDALNKASK 125 >XP_012460630.1 PREDICTED: UPF0235 protein C15orf40 homolog [Gossypium raimondii] XP_016751014.1 PREDICTED: UPF0235 protein C15orf40 homolog [Gossypium hirsutum] KJB75224.1 hypothetical protein B456_012G032800 [Gossypium raimondii] Length = 126 Score = 58.9 bits (141), Expect = 2e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDNDFK 115 VKRRQVSIGSGSKSR K+V+VEE+TLQSVFDAL+ K Sbjct: 88 VKRRQVSIGSGSKSRDKVVVVEEITLQSVFDALNKASK 125 >XP_008245124.1 PREDICTED: UPF0235 protein C15orf40-like [Prunus mume] Length = 127 Score = 58.9 bits (141), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDNDFKA 118 VKRRQVSIGSGSKSR K+V+VEE+TLQSVFD LD K+ Sbjct: 88 VKRRQVSIGSGSKSRDKVVIVEEMTLQSVFDILDKASKS 126 >XP_007221212.1 hypothetical protein PRUPE_ppa013315mg [Prunus persica] ONI01886.1 hypothetical protein PRUPE_6G165000 [Prunus persica] ONI01887.1 hypothetical protein PRUPE_6G165000 [Prunus persica] Length = 129 Score = 58.9 bits (141), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDNDFKA 118 VKRRQVSIGSGSKSR K+V+VEE+TLQSVFD LD K+ Sbjct: 90 VKRRQVSIGSGSKSRDKVVIVEEMTLQSVFDILDKASKS 128 >XP_006382826.1 hypothetical protein POPTR_0005s05820g [Populus trichocarpa] ERP60623.1 hypothetical protein POPTR_0005s05820g [Populus trichocarpa] Length = 131 Score = 58.9 bits (141), Expect = 2e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDNDFK 115 VKRRQVSIGSGSKSR K+V+VEEVTLQ+VFDAL+ K Sbjct: 92 VKRRQVSIGSGSKSRDKVVIVEEVTLQNVFDALEKASK 129 >XP_015869785.1 PREDICTED: UPF0235 protein C15orf40 homolog isoform X2 [Ziziphus jujuba] Length = 132 Score = 58.9 bits (141), Expect = 2e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDNDFKA 118 VKRRQVSIGSGSKSR K+V+VE+V+LQS+FDALD K+ Sbjct: 93 VKRRQVSIGSGSKSRDKVVIVEDVSLQSIFDALDKASKS 131 >XP_015869096.1 PREDICTED: UPF0235 protein C15orf40 homolog isoform X2 [Ziziphus jujuba] XP_015869475.1 PREDICTED: UPF0235 protein C15orf40 homolog isoform X2 [Ziziphus jujuba] XP_015869520.1 PREDICTED: UPF0235 protein C15orf40 homolog isoform X2 [Ziziphus jujuba] XP_015871289.1 PREDICTED: UPF0235 protein C15orf40 homolog isoform X2 [Ziziphus jujuba] XP_015871311.1 PREDICTED: UPF0235 protein C15orf40 homolog isoform X2 [Ziziphus jujuba] Length = 132 Score = 58.9 bits (141), Expect = 2e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDNDFKA 118 VKRRQVSIGSGSKSR K+V+VE+V+LQS+FDALD K+ Sbjct: 93 VKRRQVSIGSGSKSRDKVVIVEDVSLQSIFDALDKASKS 131 >XP_015869784.1 PREDICTED: UPF0235 protein C15orf40 homolog isoform X1 [Ziziphus jujuba] Length = 133 Score = 58.9 bits (141), Expect = 2e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDNDFKA 118 VKRRQVSIGSGSKSR K+V+VE+V+LQS+FDALD K+ Sbjct: 94 VKRRQVSIGSGSKSRDKVVIVEDVSLQSIFDALDKASKS 132 >XP_015869095.1 PREDICTED: UPF0235 protein C15orf40 homolog isoform X1 [Ziziphus jujuba] XP_015869474.1 PREDICTED: UPF0235 protein C15orf40 homolog isoform X1 [Ziziphus jujuba] XP_015869519.1 PREDICTED: UPF0235 protein C15orf40 homolog isoform X1 [Ziziphus jujuba] XP_015871288.1 PREDICTED: UPF0235 protein C15orf40 homolog isoform X1 [Ziziphus jujuba] XP_015871310.1 PREDICTED: UPF0235 protein C15orf40 homolog isoform X1 [Ziziphus jujuba] Length = 133 Score = 58.9 bits (141), Expect = 2e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +2 Query: 2 VKRRQVSIGSGSKSRGKLVLVEEVTLQSVFDALDNDFKA 118 VKRRQVSIGSGSKSR K+V+VE+V+LQS+FDALD K+ Sbjct: 94 VKRRQVSIGSGSKSRDKVVIVEDVSLQSIFDALDKASKS 132