BLASTX nr result
ID: Angelica27_contig00004480
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00004480 (334 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAW30459.1 His3, partial [Drosophila yakuba] AAW30460.1 His3, pa... 55 5e-08 XP_009570415.1 PREDICTED: histone H3.3-like, partial [Fulmarus g... 55 5e-08 ETE55830.1 hypothetical protein L345_18461, partial [Ophiophagus... 55 5e-08 XP_001618732.1 hypothetical protein NEMVEDRAFT_v1g153569 [Nemato... 55 6e-08 AAB49446.1 histone H3, partial [Drosophila virilis] 55 6e-08 EMT06638.1 hypothetical protein F775_43755 [Aegilops tauschii] 55 6e-08 XP_009792066.1 PREDICTED: histone H3.3-like, partial [Nicotiana ... 55 6e-08 OCA16471.1 hypothetical protein XENTR_v900282582mg, partial [Xen... 55 7e-08 XP_004223390.1 histone H3 [Plasmodium cynomolgi strain B] GAB674... 57 7e-08 CUT18455.1 H3.1.2, partial [Lilium davidii var. unicolor] 55 7e-08 XP_009062587.1 hypothetical protein LOTGIDRAFT_146043, partial [... 55 7e-08 CAA31968.1 histone H3 (AA 1-58), partial [Medicago sativa] 55 7e-08 CAA83209.1 histone H3 (partial), partial [Mus musculus domesticus] 55 7e-08 XP_009480619.1 PREDICTED: histone H3.3-like, partial [Pelecanus ... 55 7e-08 XP_005315503.1 PREDICTED: histone H3.3, partial [Chrysemys picta... 55 7e-08 AEL23116.1 histone H3.3-like protein, partial [Cherax quadricari... 55 7e-08 XP_014353917.1 PREDICTED: histone H3-like [Latimeria chalumnae] 55 8e-08 XP_001622256.1 predicted protein [Nematostella vectensis] EDO301... 55 8e-08 XP_003367077.1 histone H3.3 (Histone H3.2) [Trichinella spiralis... 54 8e-08 XP_003366147.1 histone H3.2 [Trichinella spiralis] EFV46268.1 hi... 54 8e-08 >AAW30459.1 His3, partial [Drosophila yakuba] AAW30460.1 His3, partial [Drosophila yakuba] AAW30461.1 His3, partial [Drosophila yakuba] AAW30462.1 His3, partial [Drosophila yakuba] AAW30463.1 His3, partial [Drosophila santomea] AAW30464.1 His3, partial [Drosophila santomea] AAW30465.1 His3, partial [Drosophila santomea] AAW30466.1 His3, partial [Drosophila santomea] AAW30467.1 His3, partial [Drosophila yakuba] AAW30468.1 His3, partial [Drosophila yakuba] AAW30469.1 His3, partial [Drosophila yakuba] AAW30470.1 His3, partial [Drosophila yakuba] AAW30471.1 His3, partial [Drosophila santomea] AAW30472.1 His3, partial [Drosophila santomea] AAW30473.1 His3, partial [Drosophila santomea] AAW30474.1 His3, partial [Drosophila santomea] Length = 38 Score = 54.7 bits (130), Expect = 5e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 5 GLFEDTNLCAIHAKRVTIMPKDIQL 29 >XP_009570415.1 PREDICTED: histone H3.3-like, partial [Fulmarus glacialis] Length = 42 Score = 54.7 bits (130), Expect = 5e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 9 GLFEDTNLCAIHAKRVTIMPKDIQL 33 >ETE55830.1 hypothetical protein L345_18461, partial [Ophiophagus hannah] Length = 45 Score = 54.7 bits (130), Expect = 5e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 13 GLFEDTNLCAIHAKRVTIMPKDIQL 37 >XP_001618732.1 hypothetical protein NEMVEDRAFT_v1g153569 [Nematostella vectensis] EDO26632.1 predicted protein, partial [Nematostella vectensis] Length = 49 Score = 54.7 bits (130), Expect = 6e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 16 GLFEDTNLCAIHAKRVTIMPKDIQL 40 >AAB49446.1 histone H3, partial [Drosophila virilis] Length = 49 Score = 54.7 bits (130), Expect = 6e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 16 GLFEDTNLCAIHAKRVTIMPKDIQL 40 >EMT06638.1 hypothetical protein F775_43755 [Aegilops tauschii] Length = 52 Score = 54.7 bits (130), Expect = 6e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 19 GLFEDTNLCAIHAKRVTIMPKDIQL 43 >XP_009792066.1 PREDICTED: histone H3.3-like, partial [Nicotiana sylvestris] XP_009794706.1 PREDICTED: histone H3.3-like, partial [Nicotiana sylvestris] Length = 54 Score = 54.7 bits (130), Expect = 6e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 21 GLFEDTNLCAIHAKRVTIMPKDIQL 45 >OCA16471.1 hypothetical protein XENTR_v900282582mg, partial [Xenopus tropicalis] Length = 56 Score = 54.7 bits (130), Expect = 7e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 23 GLFEDTNLCAIHAKRVTIMPKDIQL 47 >XP_004223390.1 histone H3 [Plasmodium cynomolgi strain B] GAB67443.1 histone H3 [Plasmodium cynomolgi strain B] Length = 151 Score = 57.0 bits (136), Expect = 7e-08 Identities = 30/49 (61%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQLXXXXXXXXXXXXGC--CYVGFKFL 193 GLFEDTNLCAIHAKRVTIMPKDIQL C ++GF FL Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRLKREITFHQDCFTTHIGFIFL 151 >CUT18455.1 H3.1.2, partial [Lilium davidii var. unicolor] Length = 57 Score = 54.7 bits (130), Expect = 7e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 24 GLFEDTNLCAIHAKRVTIMPKDIQL 48 >XP_009062587.1 hypothetical protein LOTGIDRAFT_146043, partial [Lottia gigantea] XP_009065734.1 hypothetical protein LOTGIDRAFT_146480, partial [Lottia gigantea] ESO83581.1 hypothetical protein LOTGIDRAFT_146480, partial [Lottia gigantea] ESO86729.1 hypothetical protein LOTGIDRAFT_146043, partial [Lottia gigantea] Length = 58 Score = 54.7 bits (130), Expect = 7e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 25 GLFEDTNLCAIHAKRVTIMPKDIQL 49 >CAA31968.1 histone H3 (AA 1-58), partial [Medicago sativa] Length = 58 Score = 54.7 bits (130), Expect = 7e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 25 GLFEDTNLCAIHAKRVTIMPKDIQL 49 >CAA83209.1 histone H3 (partial), partial [Mus musculus domesticus] Length = 58 Score = 54.7 bits (130), Expect = 7e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 25 GLFEDTNLCAIHAKRVTIMPKDIQL 49 >XP_009480619.1 PREDICTED: histone H3.3-like, partial [Pelecanus crispus] XP_009812998.1 PREDICTED: histone H3.3, partial [Gavia stellata] Length = 60 Score = 54.7 bits (130), Expect = 7e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 27 GLFEDTNLCAIHAKRVTIMPKDIQL 51 >XP_005315503.1 PREDICTED: histone H3.3, partial [Chrysemys picta bellii] Length = 60 Score = 54.7 bits (130), Expect = 7e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 27 GLFEDTNLCAIHAKRVTIMPKDIQL 51 >AEL23116.1 histone H3.3-like protein, partial [Cherax quadricarinatus] Length = 61 Score = 54.7 bits (130), Expect = 7e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 28 GLFEDTNLCAIHAKRVTIMPKDIQL 52 >XP_014353917.1 PREDICTED: histone H3-like [Latimeria chalumnae] Length = 62 Score = 54.7 bits (130), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 29 GLFEDTNLCAIHAKRVTIMPKDIQL 53 >XP_001622256.1 predicted protein [Nematostella vectensis] EDO30156.1 predicted protein [Nematostella vectensis] Length = 62 Score = 54.7 bits (130), Expect = 8e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKDIQL Sbjct: 29 GLFEDTNLCAIHAKRVTIMPKDIQL 53 >XP_003367077.1 histone H3.3 (Histone H3.2) [Trichinella spiralis] EFV46759.1 histone H3.3 (Histone H3.2) [Trichinella spiralis] Length = 47 Score = 54.3 bits (129), Expect = 8e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKD+QL Sbjct: 14 GLFEDTNLCAIHAKRVTIMPKDVQL 38 >XP_003366147.1 histone H3.2 [Trichinella spiralis] EFV46268.1 histone H3.2 [Trichinella spiralis] Length = 48 Score = 54.3 bits (129), Expect = 8e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 333 GLFEDTNLCAIHAKRVTIMPKDIQL 259 GLFEDTNLCAIHAKRVTIMPKD+QL Sbjct: 15 GLFEDTNLCAIHAKRVTIMPKDVQL 39