BLASTX nr result
ID: Angelica27_contig00004448
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00004448 (648 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN00464.1 hypothetical protein DCAR_009218 [Daucus carota subsp... 62 1e-09 >KZN00464.1 hypothetical protein DCAR_009218 [Daucus carota subsp. sativus] Length = 64 Score = 62.0 bits (149), Expect = 1e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 549 MAVLSKTSGLWCKIHKEGDDDDAYTYIPSVQ 457 MA+LSKTSGLWC +HKEGDDDDAYTY+P V+ Sbjct: 1 MALLSKTSGLWCTVHKEGDDDDAYTYVPCVR 31