BLASTX nr result
ID: Angelica27_contig00003892
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00003892 (220 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017230570.1 PREDICTED: cold-regulated 413 plasma membrane pro... 51 6e-06 >XP_017230570.1 PREDICTED: cold-regulated 413 plasma membrane protein 1-like [Daucus carota subsp. sativus] Length = 203 Score = 51.2 bits (121), Expect = 6e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 131 MWKGSFLQMKTDDMASSVLTSDFKELGEAA 220 MWKGSFL+MKTD A+SVL+SDFKELG+ A Sbjct: 1 MWKGSFLKMKTDTAANSVLSSDFKELGQVA 30