BLASTX nr result
ID: Angelica27_contig00003833
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00003833 (1149 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017221080.1 PREDICTED: putative B3 domain-containing protein ... 121 2e-28 KZN11183.1 hypothetical protein DCAR_003839 [Daucus carota subsp... 121 4e-28 XP_012079139.1 PREDICTED: B3 domain-containing protein Os01g0723... 61 4e-07 XP_012079138.1 PREDICTED: B3 domain-containing protein Os01g0723... 61 6e-07 >XP_017221080.1 PREDICTED: putative B3 domain-containing protein At5g66980 [Daucus carota subsp. sativus] Length = 269 Score = 121 bits (304), Expect = 2e-28 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 1/87 (1%) Frame = +2 Query: 2 PLPSPFVTKTRLARKREVKVRDPDGKKWVVKITKDGKRVGLTLGWTGVFVAHRLKKGDTC 181 PLP FV ++ LA K ++K+RDPDGKKW+VK+ +GK+ LT+GWT +FVAHRLK+GDTC Sbjct: 179 PLPLLFVRESGLADKEQIKLRDPDGKKWLVKVINEGKKAALTVGWTRLFVAHRLKRGDTC 238 Query: 182 IFTFVSRAGVE-FIQVDFKRGRGRPPK 259 IFT+V R G IQVD KRGRGRPPK Sbjct: 239 IFTYVRREGSSGIIQVDMKRGRGRPPK 265 >KZN11183.1 hypothetical protein DCAR_003839 [Daucus carota subsp. sativus] Length = 306 Score = 121 bits (304), Expect = 4e-28 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 1/87 (1%) Frame = +2 Query: 2 PLPSPFVTKTRLARKREVKVRDPDGKKWVVKITKDGKRVGLTLGWTGVFVAHRLKKGDTC 181 PLP FV ++ LA K ++K+RDPDGKKW+VK+ +GK+ LT+GWT +FVAHRLK+GDTC Sbjct: 216 PLPLLFVRESGLADKEQIKLRDPDGKKWLVKVINEGKKAALTVGWTRLFVAHRLKRGDTC 275 Query: 182 IFTFVSRAGVE-FIQVDFKRGRGRPPK 259 IFT+V R G IQVD KRGRGRPPK Sbjct: 276 IFTYVRREGSSGIIQVDMKRGRGRPPK 302 >XP_012079139.1 PREDICTED: B3 domain-containing protein Os01g0723500-like isoform X2 [Jatropha curcas] Length = 242 Score = 61.2 bits (147), Expect = 4e-07 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 4/82 (4%) Frame = +2 Query: 5 LPSPFVTKTRLARKREVKVRDPDGKKWVVK----ITKDGKRVGLTLGWTGVFVAHRLKKG 172 +P F KT+L K E+ ++DP G+ W VK + + G +V LGW+ + A+ L G Sbjct: 140 MPKDFANKTKLVSKEEIVMKDPKGRSWPVKVNILVVQRGCQVRFGLGWSQFYGANELATG 199 Query: 173 DTCIFTFVSRAGVEFIQVDFKR 238 DTC+F F++ G I+V+ + Sbjct: 200 DTCVFHFIAEKG-NLIEVEIHK 220 >XP_012079138.1 PREDICTED: B3 domain-containing protein Os01g0723500-like isoform X1 [Jatropha curcas] KDP31850.1 hypothetical protein JCGZ_12311 [Jatropha curcas] Length = 294 Score = 61.2 bits (147), Expect = 6e-07 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 4/82 (4%) Frame = +2 Query: 5 LPSPFVTKTRLARKREVKVRDPDGKKWVVK----ITKDGKRVGLTLGWTGVFVAHRLKKG 172 +P F KT+L K E+ ++DP G+ W VK + + G +V LGW+ + A+ L G Sbjct: 192 MPKDFANKTKLVSKEEIVMKDPKGRSWPVKVNILVVQRGCQVRFGLGWSQFYGANELATG 251 Query: 173 DTCIFTFVSRAGVEFIQVDFKR 238 DTC+F F++ G I+V+ + Sbjct: 252 DTCVFHFIAEKG-NLIEVEIHK 272