BLASTX nr result
ID: Angelica27_contig00003402
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00003402 (753 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM88367.1 hypothetical protein DCAR_025442 [Daucus carota subsp... 55 4e-06 >KZM88367.1 hypothetical protein DCAR_025442 [Daucus carota subsp. sativus] Length = 119 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/60 (45%), Positives = 38/60 (63%) Frame = -1 Query: 510 GNTKVEGTQGDISSSVRDPSSVCNSTVGECGTGDEVELLLMDAPGNRLLAEAPKKPNFIA 331 G+TK+ G GD +SVCN T+G+CG GDEVE+LLM +PG RL + + ++ A Sbjct: 22 GSTKLGGAAGDGYRG----ASVCNGTIGDCGAGDEVEMLLMHSPGRRLAGTSGRSISYDA 77