BLASTX nr result
ID: Angelica27_contig00003183
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00003183 (223 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017224623.1 PREDICTED: stress-response A/B barrel domain-cont... 84 2e-19 XP_017227430.1 PREDICTED: stress-response A/B barrel domain-cont... 79 2e-17 XP_014500421.1 PREDICTED: probable protein Pop3 [Vigna radiata v... 71 2e-14 XP_017409173.1 PREDICTED: stress-response A/B barrel domain-cont... 71 2e-14 XP_010941506.1 PREDICTED: stress-response A/B barrel domain-cont... 71 3e-14 XP_002280639.1 PREDICTED: stress-response A/B barrel domain-cont... 70 6e-14 KHN10211.1 Hypothetical protein glysoja_017815 [Glycine soja] KR... 70 8e-14 NP_001235728.1 uncharacterized protein LOC100305974 [Glycine max... 70 8e-14 XP_002272048.1 PREDICTED: stress-response A/B barrel domain-cont... 70 8e-14 XP_007137199.1 hypothetical protein PHAVU_009G108000g [Phaseolus... 69 2e-13 JAU22436.1 putative protein Pop3 [Noccaea caerulescens] JAU31034... 68 3e-13 KHN18185.1 Hypothetical protein glysoja_025075 [Glycine soja] 68 3e-13 XP_003526484.1 PREDICTED: probable protein Pop3 [Glycine max] KR... 68 3e-13 XP_019075360.1 PREDICTED: stress-response A/B barrel domain-cont... 69 4e-13 XP_009114452.1 PREDICTED: stress-response A/B barrel domain-cont... 68 5e-13 KYP65169.1 putative protein Pop3 [Cajanus cajan] 68 5e-13 XP_006298852.1 hypothetical protein CARUB_v10014967mg [Capsella ... 68 5e-13 XP_018435145.1 PREDICTED: stress-response A/B barrel domain-cont... 68 6e-13 KFK39059.1 hypothetical protein AALP_AA3G195600 [Arabis alpina] 67 7e-13 XP_010465748.1 PREDICTED: stress-response A/B barrel domain-cont... 67 7e-13 >XP_017224623.1 PREDICTED: stress-response A/B barrel domain-containing protein HS1-like [Daucus carota subsp. sativus] Length = 105 Score = 84.0 bits (206), Expect = 2e-19 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +2 Query: 95 MGEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 MGE KHIL+AKFT+DT+P+EIESLIKGYANLVSLVPTMKSFHW Sbjct: 1 MGEFKHILVAKFTEDTTPQEIESLIKGYANLVSLVPTMKSFHW 43 >XP_017227430.1 PREDICTED: stress-response A/B barrel domain-containing protein HS1-like [Daucus carota subsp. sativus] Length = 105 Score = 78.6 bits (192), Expect = 2e-17 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +2 Query: 95 MGEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 MGE KHIL+ KF +DT+P+EIESLIKG+ANLVSLVPTMKSFHW Sbjct: 1 MGEFKHILVVKFREDTTPQEIESLIKGFANLVSLVPTMKSFHW 43 >XP_014500421.1 PREDICTED: probable protein Pop3 [Vigna radiata var. radiata] Length = 106 Score = 71.2 bits (173), Expect = 2e-14 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KH+LLAKF DD +PE+IE LIKGYANLV+L+P MK+FHW Sbjct: 6 GVVKHLLLAKFKDDVTPEKIEELIKGYANLVNLIPPMKAFHW 47 >XP_017409173.1 PREDICTED: stress-response A/B barrel domain-containing protein HS1-like [Vigna angularis] KOM28640.1 hypothetical protein LR48_Vigan561s003000 [Vigna angularis] Length = 106 Score = 71.2 bits (173), Expect = 2e-14 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KH+LLAKF DD +PE+IE LIKGYANLV+L+P MK+FHW Sbjct: 6 GVVKHLLLAKFKDDVTPEKIEELIKGYANLVNLIPPMKAFHW 47 >XP_010941506.1 PREDICTED: stress-response A/B barrel domain-containing protein HS1 [Elaeis guineensis] Length = 109 Score = 70.9 bits (172), Expect = 3e-14 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KH+LLAKF DD SPE++E LIKGYANLVSLV MK+FHW Sbjct: 6 GVVKHVLLAKFKDDISPEQVEKLIKGYANLVSLVQPMKAFHW 47 >XP_002280639.1 PREDICTED: stress-response A/B barrel domain-containing protein HS1 [Vitis vinifera] CBI22836.3 unnamed protein product, partial [Vitis vinifera] Length = 109 Score = 70.1 bits (170), Expect = 6e-14 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KH+LLAKF D T P++IE LIKGYANLV+LVP MK+FHW Sbjct: 6 GVVKHVLLAKFKDSTPPDQIEELIKGYANLVNLVPPMKAFHW 47 >KHN10211.1 Hypothetical protein glysoja_017815 [Glycine soja] KRH62045.1 hypothetical protein GLYMA_04G082200 [Glycine max] Length = 109 Score = 69.7 bits (169), Expect = 8e-14 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KH+LLAKF DD +PE IE LIK YANLV+L+P MKSFHW Sbjct: 6 GVVKHVLLAKFKDDVTPERIEELIKDYANLVNLIPPMKSFHW 47 >NP_001235728.1 uncharacterized protein LOC100305974 [Glycine max] ACU13922.1 unknown [Glycine max] Length = 109 Score = 69.7 bits (169), Expect = 8e-14 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KH+LLAKF DD +PE IE LIK YANLV+L+P MKSFHW Sbjct: 6 GVVKHVLLAKFKDDVTPERIEELIKDYANLVNLIPPMKSFHW 47 >XP_002272048.1 PREDICTED: stress-response A/B barrel domain-containing protein HS1 [Vitis vinifera] CBI22822.3 unnamed protein product, partial [Vitis vinifera] Length = 109 Score = 69.7 bits (169), Expect = 8e-14 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KH+LLAKF D T P++IE LIKGYANLV+LVP MK+FHW Sbjct: 6 GLVKHVLLAKFKDSTPPDQIEELIKGYANLVNLVPPMKAFHW 47 >XP_007137199.1 hypothetical protein PHAVU_009G108000g [Phaseolus vulgaris] ESW09193.1 hypothetical protein PHAVU_009G108000g [Phaseolus vulgaris] Length = 106 Score = 68.9 bits (167), Expect = 2e-13 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KHI+LAKF DD + E+IE LIKGYANLV+LVP MKSFHW Sbjct: 6 GVVKHIVLAKFKDDITAEKIEELIKGYANLVNLVPPMKSFHW 47 >JAU22436.1 putative protein Pop3 [Noccaea caerulescens] JAU31034.1 putative protein Pop3 [Noccaea caerulescens] Length = 109 Score = 68.2 bits (165), Expect = 3e-13 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KH+LLAKF DD SPE+IE LI GYANLV+L+ MK+FHW Sbjct: 6 GPVKHVLLAKFKDDVSPEKIEELINGYANLVNLIEPMKAFHW 47 >KHN18185.1 Hypothetical protein glysoja_025075 [Glycine soja] Length = 109 Score = 68.2 bits (165), Expect = 3e-13 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KH+ LAKF DD +PE IE LIK YANLV+L+P MKSFHW Sbjct: 6 GVVKHVFLAKFKDDVTPERIEELIKDYANLVNLIPPMKSFHW 47 >XP_003526484.1 PREDICTED: probable protein Pop3 [Glycine max] KRH52716.1 hypothetical protein GLYMA_06G083900 [Glycine max] Length = 109 Score = 68.2 bits (165), Expect = 3e-13 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KH+ LAKF DD +PE IE LIK YANLV+L+P MKSFHW Sbjct: 6 GVVKHVFLAKFKDDVTPERIEELIKDYANLVNLIPPMKSFHW 47 >XP_019075360.1 PREDICTED: stress-response A/B barrel domain-containing protein HS1 [Vitis vinifera] Length = 129 Score = 68.6 bits (166), Expect = 4e-13 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KH+LLAKF D T P++IE LIK YANLVSL+P MK+FHW Sbjct: 26 GVVKHVLLAKFKDSTPPDQIEELIKSYANLVSLIPPMKAFHW 67 >XP_009114452.1 PREDICTED: stress-response A/B barrel domain-containing protein HS1 [Brassica rapa] Length = 107 Score = 67.8 bits (164), Expect = 5e-13 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KH+LLAKF DD +PE+I+ LIKGYANLV+L+ MK+FHW Sbjct: 6 GPVKHVLLAKFKDDVTPEKIDELIKGYANLVNLIEPMKAFHW 47 >KYP65169.1 putative protein Pop3 [Cajanus cajan] Length = 109 Score = 67.8 bits (164), Expect = 5e-13 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KH+L+AKF DD +PE IE LIK YANLV+L+P MKSFHW Sbjct: 6 GLVKHVLVAKFKDDITPERIEELIKDYANLVNLIPPMKSFHW 47 >XP_006298852.1 hypothetical protein CARUB_v10014967mg [Capsella rubella] EOA31750.1 hypothetical protein CARUB_v10014967mg [Capsella rubella] Length = 110 Score = 67.8 bits (164), Expect = 5e-13 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KHILLAKF D SPE+IE LIKGYANLV+L+ MK+FHW Sbjct: 7 GPVKHILLAKFKDGVSPEKIEELIKGYANLVNLIEPMKAFHW 48 >XP_018435145.1 PREDICTED: stress-response A/B barrel domain-containing protein HS1 [Raphanus sativus] Length = 119 Score = 67.8 bits (164), Expect = 6e-13 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KH+LLAKF DD +PE+I+ LIKGYANLV+L+ MK+FHW Sbjct: 18 GPVKHVLLAKFKDDVTPEKIDELIKGYANLVNLIEPMKAFHW 59 >KFK39059.1 hypothetical protein AALP_AA3G195600 [Arabis alpina] Length = 109 Score = 67.4 bits (163), Expect = 7e-13 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KHILLAKF DD +PE+IE LI GYANLV+L+ MK+FHW Sbjct: 6 GPVKHILLAKFKDDVTPEKIEELINGYANLVNLIEPMKAFHW 47 >XP_010465748.1 PREDICTED: stress-response A/B barrel domain-containing protein HS1 [Camelina sativa] Length = 110 Score = 67.4 bits (163), Expect = 7e-13 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 98 GEIKHILLAKFTDDTSPEEIESLIKGYANLVSLVPTMKSFHW 223 G +KH+LLAKF D SPE+IE LIKGYANLV+L+ MK+FHW Sbjct: 7 GTVKHVLLAKFKDGVSPEKIEELIKGYANLVNLIEPMKAFHW 48