BLASTX nr result
ID: Angelica27_contig00002467
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00002467 (330 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAC32125.1 actin, partial [Picea mariana] 85 6e-20 WP_071414478.1 hypothetical protein [Acinetobacter baumannii] OI... 85 1e-19 JAU90273.1 Actin, partial [Noccaea caerulescens] 85 1e-19 JAU26149.1 Actin, partial [Noccaea caerulescens] 85 2e-19 JAU98109.1 Actin [Noccaea caerulescens] 85 2e-19 BAB60900.1 actin, partial [Ipomoea nil] 85 2e-19 CAA10126.1 actin, partial [Cicer arietinum] 85 2e-19 AFK39692.1 unknown [Medicago truncatula] 85 3e-19 JAU24264.1 Actin-3, partial [Noccaea caerulescens] 85 3e-19 AAC60565.1 actin, partial [Striga asiatica] 85 3e-19 AHA91825.1 actin-1, partial [Rosa hybrid cultivar] 84 4e-19 AEG78680.1 actin, partial [Erythroxylum coca] 82 6e-19 AML60265.1 actin 4, partial [Morus alba] 82 6e-19 KDO53390.1 hypothetical protein CISIN_1g040984mg [Citrus sinensis] 82 7e-19 XP_013073050.1 PREDICTED: actin, alpha skeletal muscle [Biomphal... 84 7e-19 AAT37544.1 actin 1.6, partial [Hydra vulgaris] AAT37545.1 actin ... 82 8e-19 AAX92681.1 actin, partial [Picea abies] 85 9e-19 AAW83504.1 actin, partial [Ipomoea batatas] 83 9e-19 KHN84516.1 Actin-1 [Toxocara canis] KIH65223.1 hypothetical prot... 82 1e-18 CAB61444.1 unnamed protein product, partial [Drosophila melanoga... 82 1e-18 >AAC32125.1 actin, partial [Picea mariana] Length = 53 Score = 85.1 bits (209), Expect = 6e-20 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 15 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 53 >WP_071414478.1 hypothetical protein [Acinetobacter baumannii] OIC63224.1 hypothetical protein A7L55_18690 [Acinetobacter baumannii] Length = 71 Score = 85.1 bits (209), Expect = 1e-19 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 33 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 71 >JAU90273.1 Actin, partial [Noccaea caerulescens] Length = 79 Score = 85.1 bits (209), Expect = 1e-19 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 41 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 79 >JAU26149.1 Actin, partial [Noccaea caerulescens] Length = 90 Score = 85.1 bits (209), Expect = 2e-19 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 52 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 90 >JAU98109.1 Actin [Noccaea caerulescens] Length = 93 Score = 85.1 bits (209), Expect = 2e-19 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 55 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 93 >BAB60900.1 actin, partial [Ipomoea nil] Length = 100 Score = 85.1 bits (209), Expect = 2e-19 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 62 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 100 >CAA10126.1 actin, partial [Cicer arietinum] Length = 103 Score = 85.1 bits (209), Expect = 2e-19 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 65 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 103 >AFK39692.1 unknown [Medicago truncatula] Length = 110 Score = 85.1 bits (209), Expect = 3e-19 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 72 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 110 >JAU24264.1 Actin-3, partial [Noccaea caerulescens] Length = 113 Score = 85.1 bits (209), Expect = 3e-19 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 75 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 113 >AAC60565.1 actin, partial [Striga asiatica] Length = 114 Score = 85.1 bits (209), Expect = 3e-19 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 76 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 114 >AHA91825.1 actin-1, partial [Rosa hybrid cultivar] Length = 84 Score = 84.0 bits (206), Expect = 4e-19 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWI+KAEYDESGPSIVHRKCF Sbjct: 46 YSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 84 >AEG78680.1 actin, partial [Erythroxylum coca] Length = 45 Score = 82.4 bits (202), Expect = 6e-19 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 7 YSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 45 >AML60265.1 actin 4, partial [Morus alba] Length = 47 Score = 82.4 bits (202), Expect = 6e-19 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 9 YSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 47 >KDO53390.1 hypothetical protein CISIN_1g040984mg [Citrus sinensis] Length = 51 Score = 82.4 bits (202), Expect = 7e-19 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 13 YSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 51 >XP_013073050.1 PREDICTED: actin, alpha skeletal muscle [Biomphalaria glabrata] Length = 107 Score = 84.0 bits (206), Expect = 7e-19 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWI+KAEYDESGPSIVHRKCF Sbjct: 69 YSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 107 >AAT37544.1 actin 1.6, partial [Hydra vulgaris] AAT37545.1 actin 1.7, partial [Hydra vulgaris] Length = 45 Score = 82.0 bits (201), Expect = 8e-19 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 7 YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 45 >AAX92681.1 actin, partial [Picea abies] Length = 155 Score = 85.1 bits (209), Expect = 9e-19 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF Sbjct: 117 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 155 >AAW83504.1 actin, partial [Ipomoea batatas] Length = 77 Score = 82.8 bits (203), Expect = 9e-19 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLST QQMWIAKAEYDESGPSIVHRKCF Sbjct: 39 YSVWIGGSILASLSTLQQMWIAKAEYDESGPSIVHRKCF 77 >KHN84516.1 Actin-1 [Toxocara canis] KIH65223.1 hypothetical protein ANCDUO_04453 [Ancylostoma duodenale] Length = 51 Score = 82.0 bits (201), Expect = 1e-18 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 13 YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 51 >CAB61444.1 unnamed protein product, partial [Drosophila melanogaster] Length = 53 Score = 82.0 bits (201), Expect = 1e-18 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 329 YSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 213 YSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 15 YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 53