BLASTX nr result
ID: Angelica27_contig00001218
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00001218 (822 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AGC78878.1 hypothetical protein (mitochondrion) [Vicia faba] AGC... 111 9e-28 AFK42885.1 unknown [Lotus japonicus] 108 1e-26 EEF27214.1 conserved hypothetical protein [Ricinus communis] 95 2e-21 AFB77178.1 ATPase subunit 9 (mitochondrion) [Daucus carota subsp... 78 5e-15 AFB77177.1 ATPase subunit 9 (mitochondrion) [Daucus carota subsp... 77 2e-14 OAY74184.1 hypothetical protein ACMD2_14106 [Ananas comosus] 72 4e-13 OMO88189.1 hypothetical protein CCACVL1_08534 [Corchorus capsula... 69 6e-12 CAA08795.1 F0-F1 ATPase subunit 9 (mitochondrion) [Daucus carota... 70 8e-12 ABE72969.1 ATPase (mitochondrion) [Camellia sinensis] 69 1e-11 AFB77179.1 ATPase subunit 9 (mitochondrion) [Daucus carota subsp... 68 3e-11 AKG50126.1 ATPase subunit 9, partial [Betula luminifera] 68 4e-11 ALJ78513.1 Atp9 (mitochondrion) [Malus hupehensis var. mengshane... 67 1e-10 ACU30263.1 ATP synthase subunit 9, partial (mitochondrion) [Sile... 65 2e-10 ABV25303.1 ATP synthase subunit 9, partial (mitochondrion) [Sile... 65 2e-10 ABV25274.1 ATP synthase subunit 9, partial (mitochondrion) [Sile... 65 2e-10 ABV25236.1 ATP synthase subunit 9, partial (mitochondrion) [Sile... 65 2e-10 ABV25234.1 ATP synthase subunit 9, partial (mitochondrion) [Sile... 65 2e-10 AAW30248.1 ATP synthase F0 subunit 9, partial (mitochondrion) [A... 65 2e-10 AAW30242.1 ATP synthase F0 subunit 9, partial (mitochondrion) [P... 65 2e-10 EEF22810.1 ATP synthase 9 mitochondrial, putative, partial [Rici... 65 2e-10 >AGC78878.1 hypothetical protein (mitochondrion) [Vicia faba] AGC78917.1 hypothetical protein (mitochondrion) [Vicia faba] Length = 90 Score = 111 bits (278), Expect = 9e-28 Identities = 50/78 (64%), Positives = 59/78 (75%) Frame = -2 Query: 383 IHYVRRCKINRCRSCYNCFGGSCYWNWKRFQFFDSFCSTQSIIGKTIIWLCHFRLCADRG 204 I VRRCKINRCRSCYNCF GSC WKR QF +SF +SIIGKT+I +C+ LC++RG Sbjct: 10 IRDVRRCKINRCRSCYNCFSGSCCRYWKRIQFINSFRGKKSIIGKTVIRICNPGLCSNRG 69 Query: 203 YCIVCSNDGFFDLICILN 150 YC+V NDG FD IC L+ Sbjct: 70 YCLVRINDGLFDSICFLS 87 >AFK42885.1 unknown [Lotus japonicus] Length = 90 Score = 108 bits (271), Expect = 1e-26 Identities = 48/78 (61%), Positives = 58/78 (74%) Frame = -2 Query: 383 IHYVRRCKINRCRSCYNCFGGSCYWNWKRFQFFDSFCSTQSIIGKTIIWLCHFRLCADRG 204 I VRRCKINRCRSCYNCF GSC WKR QF +SF +SIIGK +I +C+ LC++RG Sbjct: 10 IRDVRRCKINRCRSCYNCFSGSCCRYWKRIQFINSFRGKKSIIGKAVIRICNPGLCSNRG 69 Query: 203 YCIVCSNDGFFDLICILN 150 YC+V NDG FD +C L+ Sbjct: 70 YCLVRINDGLFDSLCFLS 87 >EEF27214.1 conserved hypothetical protein [Ricinus communis] Length = 84 Score = 95.1 bits (235), Expect = 2e-21 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +3 Query: 579 ASFLHRAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSHRSARFVLISD 722 +SFL+RAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTS+RSARFVLI D Sbjct: 37 SSFLYRAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSYRSARFVLIPD 84 >AFB77178.1 ATPase subunit 9 (mitochondrion) [Daucus carota subsp. carota] AFB77183.1 ATPase subunit 9 (mitochondrion) [Daucus carota subsp. carota] AFB77184.1 ATPase subunit 9 (mitochondrion) [Daucus carota subsp. carota] Length = 88 Score = 78.2 bits (191), Expect = 5e-15 Identities = 44/62 (70%), Positives = 44/62 (70%) Frame = -3 Query: 301 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEXXXXXXXXXXXXXXXXXXIQNRVYISNI 122 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE IQNRVYISNI Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILSVFQIQNRVYISNI 85 Query: 121 VS 116 VS Sbjct: 86 VS 87 >AFB77177.1 ATPase subunit 9 (mitochondrion) [Daucus carota subsp. carota] AFB77181.1 ATPase subunit 9 (mitochondrion) [Daucus carota subsp. carota] Length = 88 Score = 76.6 bits (187), Expect = 2e-14 Identities = 43/62 (69%), Positives = 44/62 (70%) Frame = -3 Query: 301 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEXXXXXXXXXXXXXXXXXXIQNRVYISNI 122 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE I+NRVYISNI Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILSVFQIKNRVYISNI 85 Query: 121 VS 116 VS Sbjct: 86 VS 87 >OAY74184.1 hypothetical protein ACMD2_14106 [Ananas comosus] Length = 63 Score = 72.4 bits (176), Expect = 4e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 606 MSPEQSQYIWRKTIPHIEVGMGSGVFTSHRSAR 704 MSPEQSQYIWRKTIPHIEVGMGSGVFTSHRSAR Sbjct: 1 MSPEQSQYIWRKTIPHIEVGMGSGVFTSHRSAR 33 >OMO88189.1 hypothetical protein CCACVL1_08534 [Corchorus capsularis] Length = 39 Score = 68.6 bits (166), Expect = 6e-12 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +3 Query: 606 MSPEQSQYIWRKTIPHIEVGMGSGVFTSHRSARFVLISD 722 MS EQSQYIWRKTI HIEVGMGSGVF S+ SARFVLISD Sbjct: 1 MSLEQSQYIWRKTISHIEVGMGSGVFMSYCSARFVLISD 39 >CAA08795.1 F0-F1 ATPase subunit 9 (mitochondrion) [Daucus carota subsp. sativus] AAK00525.1 ATPase9 (mitochondrion) [Daucus carota] Length = 89 Score = 69.7 bits (169), Expect = 8e-12 Identities = 39/57 (68%), Positives = 39/57 (68%) Frame = -3 Query: 301 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEXXXXXXXXXXXXXXXXXXIQNRVYI 131 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE IQNRVYI Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILSVFQIQNRVYI 82 >ABE72969.1 ATPase (mitochondrion) [Camellia sinensis] Length = 85 Score = 68.9 bits (167), Expect = 1e-11 Identities = 43/77 (55%), Positives = 45/77 (58%) Frame = -3 Query: 436 KKRDENSRIR*RILLLDTYIMLEXXXXXXXXXXXXXXXXXXXXXGNVFSSLIHSVARNPS 257 KKRDENS++ MLE GNVFSSLIHSVARNPS Sbjct: 2 KKRDENSQLE----------MLEGAKLMGAGAATIALAGAAVGIGNVFSSLIHSVARNPS 51 Query: 256 LAKQLFGYAILGFALTE 206 LAKQLFGYAILGFALTE Sbjct: 52 LAKQLFGYAILGFALTE 68 >AFB77179.1 ATPase subunit 9 (mitochondrion) [Daucus carota subsp. carota] AFB77182.1 ATPase subunit 9 (mitochondrion) [Daucus carota subsp. carota] Length = 89 Score = 68.2 bits (165), Expect = 3e-11 Identities = 37/57 (64%), Positives = 39/57 (68%) Frame = -3 Query: 301 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEXXXXXXXXXXXXXXXXXXIQNRVYI 131 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE ++NRVYI Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILSVFQMKNRVYI 82 >AKG50126.1 ATPase subunit 9, partial [Betula luminifera] Length = 85 Score = 67.8 bits (164), Expect = 4e-11 Identities = 43/77 (55%), Positives = 45/77 (58%) Frame = -3 Query: 436 KKRDENSRIR*RILLLDTYIMLEXXXXXXXXXXXXXXXXXXXXXGNVFSSLIHSVARNPS 257 KKRDENS+ + MLE GNVFSSLIHSVARNPS Sbjct: 2 KKRDENSQPK----------MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPS 51 Query: 256 LAKQLFGYAILGFALTE 206 LAKQLFGYAILGFALTE Sbjct: 52 LAKQLFGYAILGFALTE 68 >ALJ78513.1 Atp9 (mitochondrion) [Malus hupehensis var. mengshanensis] Length = 93 Score = 66.6 bits (161), Expect = 1e-10 Identities = 42/77 (54%), Positives = 44/77 (57%) Frame = -3 Query: 436 KKRDENSRIR*RILLLDTYIMLEXXXXXXXXXXXXXXXXXXXXXGNVFSSLIHSVARNPS 257 KKRDENS++ MLE GNVFSSLIHSVARNPS Sbjct: 2 KKRDENSQLE----------MLEGAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPS 51 Query: 256 LAKQLFGYAILGFALTE 206 LAKQ FGYAILGFALTE Sbjct: 52 LAKQSFGYAILGFALTE 68 >ACU30263.1 ATP synthase subunit 9, partial (mitochondrion) [Silene delicatula] ACU30281.1 ATP synthase subunit 9, partial (mitochondrion) [Silene nana] Length = 56 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 301 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 206 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >ABV25303.1 ATP synthase subunit 9, partial (mitochondrion) [Silene noctiflora] ACU30254.1 ATP synthase subunit 9, partial (mitochondrion) [Silene ammophila] ACU30260.1 ATP synthase subunit 9, partial (mitochondrion) [Silene conica] ACU30268.1 ATP synthase subunit 9, partial (mitochondrion) [Silene gallinyi] ACU30270.1 ATP synthase subunit 9, partial (mitochondrion) [Silene imbricata] ACU30277.1 ATP synthase subunit 9, partial (mitochondrion) [Silene macrodonta] ACU30282.1 ATP synthase subunit 9, partial (mitochondrion) [Silene niceensis] ACU30286.1 ATP synthase subunit 9, partial (mitochondrion) [Silene pygmaea] ACU30290.1 ATP synthase subunit 9, partial (mitochondrion) [Silene schafta] ACU30295.1 ATP synthase subunit 9, partial (mitochondrion) [Silene turkestanica] Length = 56 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 301 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 206 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >ABV25274.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25275.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25276.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25277.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25278.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25279.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25280.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25281.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25282.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25283.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25284.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25285.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25286.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25287.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25288.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25289.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25290.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25291.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25292.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25293.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25294.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25295.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25296.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25297.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25298.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25299.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25300.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ABV25301.1 ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] ACU30247.1 ATP synthase subunit 9, partial (mitochondrion) [Agrostemma githago] ACU30249.1 ATP synthase subunit 9, partial (mitochondrion) [Silene laeta] ACU30251.1 ATP synthase subunit 9, partial (mitochondrion) [Petrocoptis pyrenaica] ACU30252.1 ATP synthase subunit 9, partial (mitochondrion) [Silene acutifolia] ACU30253.1 ATP synthase subunit 9, partial (mitochondrion) [Silene akinfievii] ACU30261.1 ATP synthase subunit 9, partial (mitochondrion) [Silene cordifolia] ACU30269.1 ATP synthase subunit 9, partial (mitochondrion) [Silene hookeri] ACU30271.1 ATP synthase subunit 9, partial (mitochondrion) [Silene integripetala] ACU30273.1 ATP synthase subunit 9, partial (mitochondrion) [Silene khasiana] ACU30274.1 ATP synthase subunit 9, partial (mitochondrion) [Silene lacera] ACU30278.1 ATP synthase subunit 9, partial (mitochondrion) [Silene menziesii] ACU30292.1 ATP synthase subunit 9, partial (mitochondrion) [Silene sordida] Length = 56 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 301 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 206 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >ABV25236.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ACU30296.1 ATP synthase subunit 9, partial (mitochondrion) [Silene uniflora] Length = 56 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 301 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 206 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >ABV25234.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25235.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25237.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25238.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25239.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25240.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25242.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25243.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25244.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25245.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25246.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25247.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25248.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25249.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25250.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25251.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25252.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25253.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25254.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25255.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25256.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25258.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25260.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25261.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25262.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25263.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25264.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25265.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25266.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25267.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25268.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25269.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25270.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25271.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25272.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25273.1 ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] ABV25302.1 ATP synthase subunit 9, partial (mitochondrion) [Silene acaulis] ABV25304.1 ATP synthase subunit 9, partial (mitochondrion) [Silene paradoxa] ABV25305.1 ATP synthase subunit 9, partial (mitochondrion) [Silene stellata] ABV25306.1 ATP synthase subunit 9, partial (mitochondrion) [Silene coronaria] ACU30248.1 ATP synthase subunit 9, partial (mitochondrion) [Atocion lerchenfeldianum] ACU30250.1 ATP synthase subunit 9, partial (mitochondrion) [Heliosperma pusillum] ACU30256.1 ATP synthase subunit 9, partial (mitochondrion) [Silene argentina] ACU30257.1 ATP synthase subunit 9, partial (mitochondrion) [Silene auriculata] ACU30258.1 ATP synthase subunit 9, partial (mitochondrion) [Silene caesia] ACU30262.1 ATP synthase subunit 9, partial (mitochondrion) [Silene davidii] ACU30264.1 ATP synthase subunit 9, partial (mitochondrion) [Silene dichotoma] ACU30265.1 ATP synthase subunit 9, partial (mitochondrion) [Silene douglasii] ACU30266.1 ATP synthase subunit 9, partial (mitochondrion) [Silene flavescens] ACU30267.1 ATP synthase subunit 9, partial (mitochondrion) [Silene fruticosa] ACU30272.1 ATP synthase subunit 9, partial (mitochondrion) [Silene involucrata] ACU30275.1 ATP synthase subunit 9, partial (mitochondrion) [Silene laciniata] ACU30276.1 ATP synthase subunit 9, partial (mitochondrion) [Silene littorea] ACU30279.1 ATP synthase subunit 9, partial (mitochondrion) [Silene multicaulis] ACU30280.1 ATP synthase subunit 9, partial (mitochondrion) [Silene muscipula] ACU30283.1 ATP synthase subunit 9, partial (mitochondrion) [Silene odontopetala] ACU30284.1 ATP synthase subunit 9, partial (mitochondrion) [Silene paradoxa] ACU30285.1 ATP synthase subunit 9, partial (mitochondrion) [Silene paucifolia] ACU30288.1 ATP synthase subunit 9, partial (mitochondrion) [Silene sachalinensis] ACU30291.1 ATP synthase subunit 9, partial (mitochondrion) [Silene seoulensis] ACU30298.1 ATP synthase subunit 9, partial (mitochondrion) [Silene yemensis] ACU30299.1 ATP synthase subunit 9, partial (mitochondrion) [Silene zawadskii] ACU30300.1 ATP synthase subunit 9, partial (mitochondrion) [Viscaria alpina] Length = 56 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 301 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 206 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >AAW30248.1 ATP synthase F0 subunit 9, partial (mitochondrion) [Aloe vera] Length = 59 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 301 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 206 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >AAW30242.1 ATP synthase F0 subunit 9, partial (mitochondrion) [Piper betle] Length = 59 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 301 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 206 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >EEF22810.1 ATP synthase 9 mitochondrial, putative, partial [Ricinus communis] Length = 61 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 301 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 206 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 57