BLASTX nr result
ID: Angelica27_contig00000469
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00000469 (214 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017249571.1 PREDICTED: uncharacterized protein At1g15400 [Dau... 83 4e-19 >XP_017249571.1 PREDICTED: uncharacterized protein At1g15400 [Daucus carota subsp. sativus] KZM94583.1 hypothetical protein DCAR_017826 [Daucus carota subsp. sativus] Length = 109 Score = 83.2 bits (204), Expect = 4e-19 Identities = 41/61 (67%), Positives = 41/61 (67%) Frame = +1 Query: 1 KGKEEQQRQAYKTVEVTPTVDPPSPKVSAGCGICFGXXXXXXXXXXXXXXXXXPSGGHRK 180 KGKEEQQRQAYKTVEVTPTVDPPSPKVSAGCGICFG GHRK Sbjct: 49 KGKEEQQRQAYKTVEVTPTVDPPSPKVSAGCGICFGKSKPAKKTATAAAAKRSKPSGHRK 108 Query: 181 S 183 S Sbjct: 109 S 109