BLASTX nr result
ID: Angelica23_contig00047118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00047118 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305285.1| predicted protein [Populus trichocarpa] gi|2... 71 1e-10 ref|XP_004156879.1| PREDICTED: pentatricopeptide repeat-containi... 68 9e-10 ref|XP_004152353.1| PREDICTED: pentatricopeptide repeat-containi... 68 9e-10 ref|XP_002530894.1| pentatricopeptide repeat-containing protein,... 68 9e-10 ref|XP_003516732.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 >ref|XP_002305285.1| predicted protein [Populus trichocarpa] gi|222848249|gb|EEE85796.1| predicted protein [Populus trichocarpa] Length = 523 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -1 Query: 133 LVNNLSRILSDFRNPKHDIETALIPFSSNVSTNLVEQVLKRCKN 2 LVN +SRILSD RNP HD+ET+L FSS +STNLVEQVLKRCKN Sbjct: 47 LVNEISRILSDQRNPHHDLETSLNAFSSEISTNLVEQVLKRCKN 90 >ref|XP_004156879.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like [Cucumis sativus] Length = 529 Score = 67.8 bits (164), Expect = 9e-10 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -1 Query: 133 LVNNLSRILSDFRNPKHDIETALIPFSSNVSTNLVEQVLKRCKN 2 LV+ +SRILSD RNP HD+E L FSSNVST+LVEQVLKRCKN Sbjct: 50 LVSEISRILSDRRNPHHDLEVGLSSFSSNVSTDLVEQVLKRCKN 93 >ref|XP_004152353.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like [Cucumis sativus] Length = 529 Score = 67.8 bits (164), Expect = 9e-10 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -1 Query: 133 LVNNLSRILSDFRNPKHDIETALIPFSSNVSTNLVEQVLKRCKN 2 LV+ +SRILSD RNP HD+E L FSSNVST+LVEQVLKRCKN Sbjct: 50 LVSEISRILSDRRNPHHDLEVGLSSFSSNVSTDLVEQVLKRCKN 93 >ref|XP_002530894.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529547|gb|EEF31500.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 519 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -1 Query: 136 ELVNNLSRILSDFRNPKHDIETALIPFSSNVSTNLVEQVLKRCKN 2 +LVN +SRILSD RNP HD+E +L +SS++ST LVEQVLKRCKN Sbjct: 42 DLVNEISRILSDHRNPHHDLELSLTTYSSHISTTLVEQVLKRCKN 86 >ref|XP_003516732.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like [Glycine max] Length = 523 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -1 Query: 136 ELVNNLSRILSDFRNPKHDIETALIPFSSNVSTNLVEQVLKRCKN 2 +LVN +SR+LSD R P HD+E +L PFS+ +STNLVEQVLKRCKN Sbjct: 45 DLVNEISRLLSDHRYPHHDLELSLNPFSAQLSTNLVEQVLKRCKN 89