BLASTX nr result
ID: Angelica23_contig00047074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00047074 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containi... 93 2e-17 ref|NP_179305.2| pentatricopeptide repeat-containing protein [Ar... 84 9e-15 ref|XP_002884041.1| binding protein [Arabidopsis lyrata subsp. l... 84 1e-14 ref|XP_002527150.1| pentatricopeptide repeat-containing protein,... 83 2e-14 ref|XP_003530995.1| PREDICTED: pentatricopeptide repeat-containi... 79 3e-13 >ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Vitis vinifera] gi|297744485|emb|CBI37747.3| unnamed protein product [Vitis vinifera] Length = 878 Score = 93.2 bits (230), Expect = 2e-17 Identities = 39/56 (69%), Positives = 48/56 (85%) Frame = +2 Query: 29 EKSKKYRGSDWKTIVHRDDGSGTALRTLRRVQKGWGQGSISSFQPPKSDYLDDWDG 196 +K K+ GSDW+TI+HRDDGSG AL+ L+RVQKGWGQGSISS QP K+D+LD W+G Sbjct: 821 QKRNKFSGSDWQTIIHRDDGSGLALKALKRVQKGWGQGSISSLQPQKNDFLDYWEG 876 >ref|NP_179305.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122223754|sp|Q0WPZ6.1|PP158_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g17140 gi|110737729|dbj|BAF00803.1| hypothetical protein [Arabidopsis thaliana] gi|330251496|gb|AEC06590.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 874 Score = 84.3 bits (207), Expect = 9e-15 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +2 Query: 29 EKSKKYRGSDWKTIVHRDDGSGTALRTLRRVQKGWGQGSISSFQPPKSDYLDDWD 193 +K K G++W+ I+HRDDGSG ALR+L RV+KGWGQG ISSFQPP+ DYLD W+ Sbjct: 817 KKHNKNGGNNWQNILHRDDGSGIALRSLSRVKKGWGQGDISSFQPPRVDYLDYWE 871 >ref|XP_002884041.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297329881|gb|EFH60300.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 874 Score = 84.0 bits (206), Expect = 1e-14 Identities = 35/55 (63%), Positives = 45/55 (81%) Frame = +2 Query: 29 EKSKKYRGSDWKTIVHRDDGSGTALRTLRRVQKGWGQGSISSFQPPKSDYLDDWD 193 +K KY G++W+ I+HRDDGSG AL++L RV+KGWGQG ISSFQP + DYLD W+ Sbjct: 817 KKHNKYSGNNWQNILHRDDGSGIALKSLSRVKKGWGQGDISSFQPQRVDYLDYWE 871 >ref|XP_002527150.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533489|gb|EEF35232.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 874 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/59 (61%), Positives = 43/59 (72%) Frame = +2 Query: 23 VYEKSKKYRGSDWKTIVHRDDGSGTALRTLRRVQKGWGQGSISSFQPPKSDYLDDWDGN 199 + K G+DW IVHRDDGSG AL+ L+RVQKGWGQGSISS QP K ++ D WDG+ Sbjct: 815 ILRNKNKDAGNDWPIIVHRDDGSGIALKALKRVQKGWGQGSISSLQPQKLEFFDYWDGS 873 >ref|XP_003530995.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Glycine max] Length = 875 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/56 (64%), Positives = 46/56 (82%) Frame = +2 Query: 32 KSKKYRGSDWKTIVHRDDGSGTALRTLRRVQKGWGQGSISSFQPPKSDYLDDWDGN 199 K K GSDW+ I++RD GSG AL+TL+RVQKGWGQGSISS QP ++D+LD +DG+ Sbjct: 819 KLLKDGGSDWQDIINRDAGSGIALKTLKRVQKGWGQGSISSLQPQQNDFLDYYDGS 874