BLASTX nr result
ID: Angelica23_contig00047030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00047030 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002441118.1| hypothetical protein SORBIDRAFT_09g020780 [S... 57 2e-06 ref|XP_002520319.1| kinase, putative [Ricinus communis] gi|22354... 55 8e-06 >ref|XP_002441118.1| hypothetical protein SORBIDRAFT_09g020780 [Sorghum bicolor] gi|241946403|gb|EES19548.1| hypothetical protein SORBIDRAFT_09g020780 [Sorghum bicolor] Length = 649 Score = 56.6 bits (135), Expect = 2e-06 Identities = 22/45 (48%), Positives = 30/45 (66%) Frame = +3 Query: 72 SCPIDFSYVKTLQWEKSDCIGKSVNINTCCGTIRSLLGLGLAIHL 206 SCP+D SYV+T W+ + C G + N+ CC T+ SL G+GLA L Sbjct: 36 SCPLDLSYVRTFPWDPTSCAGAAPNVTACCQTLLSLFGIGLAERL 80 >ref|XP_002520319.1| kinase, putative [Ricinus communis] gi|223540538|gb|EEF42105.1| kinase, putative [Ricinus communis] Length = 562 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 4/72 (5%) Frame = +3 Query: 9 LISILWLLCFTI----FFFITYAKTSCPIDFSYVKTLQWEKSDCIGKSVNINTCCGTIRS 176 L S L+ F I F + +SCPIDFSYV+T W+ S C + + CC T+ S Sbjct: 8 LSSFLYFFLFAISASYFSISASSSSSCPIDFSYVQTTPWDTSGC--RKPDQGHCCVTLLS 65 Query: 177 LLGLGLAIHLNK 212 L G+GLA HL + Sbjct: 66 LFGMGLAQHLRE 77