BLASTX nr result
ID: Angelica23_contig00046953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00046953 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20261.3| unnamed protein product [Vitis vinifera] 68 9e-10 ref|XP_002282646.1| PREDICTED: putative pentatricopeptide repeat... 68 9e-10 emb|CAN62355.1| hypothetical protein VITISV_022418 [Vitis vinifera] 68 9e-10 ref|XP_002532249.1| pentatricopeptide repeat-containing protein,... 63 3e-08 ref|XP_004139864.1| PREDICTED: putative pentatricopeptide repeat... 60 2e-07 >emb|CBI20261.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/55 (56%), Positives = 45/55 (81%), Gaps = 3/55 (5%) Frame = +1 Query: 85 AIKIQTILK---NQNVYDIERALNQCQISLSEVLVLNVLKRHRSDWKPAYAFFIW 240 A+++Q +LK + +V +IE AL+QC++SL++ LVL+VLKRHRSDW+PAY FF W Sbjct: 87 ALEVQNLLKTYRDSSVSEIEGALHQCRLSLTDDLVLDVLKRHRSDWRPAYVFFNW 141 >ref|XP_002282646.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Vitis vinifera] Length = 546 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/55 (56%), Positives = 45/55 (81%), Gaps = 3/55 (5%) Frame = +1 Query: 85 AIKIQTILK---NQNVYDIERALNQCQISLSEVLVLNVLKRHRSDWKPAYAFFIW 240 A+++Q +LK + +V +IE AL+QC++SL++ LVL+VLKRHRSDW+PAY FF W Sbjct: 87 ALEVQNLLKTYRDSSVSEIEGALHQCRLSLTDDLVLDVLKRHRSDWRPAYVFFNW 141 >emb|CAN62355.1| hypothetical protein VITISV_022418 [Vitis vinifera] Length = 546 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/55 (56%), Positives = 45/55 (81%), Gaps = 3/55 (5%) Frame = +1 Query: 85 AIKIQTILK---NQNVYDIERALNQCQISLSEVLVLNVLKRHRSDWKPAYAFFIW 240 A+++Q +LK + +V +IE AL+QC++SL++ LVL+VLKRHRSDW+PAY FF W Sbjct: 87 ALEVQNLLKTYRDSSVSEIEGALHQCRLSLTDDLVLDVLKRHRSDWRPAYVFFNW 141 >ref|XP_002532249.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528067|gb|EEF30143.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 507 Score = 62.8 bits (151), Expect = 3e-08 Identities = 38/83 (45%), Positives = 48/83 (57%), Gaps = 4/83 (4%) Frame = +1 Query: 4 FFPLKS-QFAIRRRLNQECDNTTGHDNEAIKIQTILKNQN---VYDIERALNQCQISLSE 171 +FP KS +FA L + G A+K+Q +LKN IE AL QC +++E Sbjct: 23 YFPTKSLEFAKSHSLIEFQQEPPGE--LALKVQNVLKNYRDSPTRKIELALTQCNPTVTE 80 Query: 172 VLVLNVLKRHRSDWKPAYAFFIW 240 L+L VLKRHRSDWKPA FF W Sbjct: 81 DLILKVLKRHRSDWKPALIFFNW 103 >ref|XP_004139864.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Cucumis sativus] gi|449502917|ref|XP_004161779.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15200-like [Cucumis sativus] Length = 532 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/58 (48%), Positives = 40/58 (68%), Gaps = 3/58 (5%) Frame = +1 Query: 76 DNEAIKIQTIL---KNQNVYDIERALNQCQISLSEVLVLNVLKRHRSDWKPAYAFFIW 240 D A+ +Q +L +++ V DIERAL+ C + L++ VL VL+RHRSDW PA+ FF W Sbjct: 89 DPSAVYVQNVLYFRRHKPVEDIERALSLCDLVLTDDFVLKVLRRHRSDWNPAFIFFNW 146