BLASTX nr result
ID: Angelica23_contig00046815
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00046815 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABA81857.1| ripening regulated protein-like [Solanum tuberosum] 59 5e-07 ref|XP_002535145.1| Quinone oxidoreductase, putative [Ricinus co... 58 7e-07 ref|XP_003552103.1| PREDICTED: putative quinone-oxidoreductase h... 57 2e-06 dbj|BAA83082.1| LEDI-4 protein [Lithospermum erythrorhizon] 56 3e-06 ref|XP_002531075.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >gb|ABA81857.1| ripening regulated protein-like [Solanum tuberosum] Length = 329 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 115 VYYTSYGGGAISLKHGEITVPTPKKDEVLIKTEAVSIN 2 V Y SYGGGA +LKH E+ VPTP KDEVL+K EA SIN Sbjct: 9 VQYDSYGGGAAALKHVEVPVPTPTKDEVLVKVEATSIN 46 >ref|XP_002535145.1| Quinone oxidoreductase, putative [Ricinus communis] gi|223523933|gb|EEF27237.1| Quinone oxidoreductase, putative [Ricinus communis] Length = 329 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -2 Query: 115 VYYTSYGGGAISLKHGEITVPTPKKDEVLIKTEAVSIN 2 V Y YGGGA LKH E+ VP+PKKDE+L+K EA+S+N Sbjct: 9 VQYDKYGGGAAGLKHAEVPVPSPKKDEILVKVEAISMN 46 >ref|XP_003552103.1| PREDICTED: putative quinone-oxidoreductase homolog, chloroplastic-like [Glycine max] Length = 329 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -2 Query: 115 VYYTSYGGGAISLKHGEITVPTPKKDEVLIKTEAVSIN 2 V Y SYGGG LKH E+ +PTP KDEVLIK EA SIN Sbjct: 9 VQYDSYGGGPAGLKHVEVPIPTPSKDEVLIKVEAASIN 46 >dbj|BAA83082.1| LEDI-4 protein [Lithospermum erythrorhizon] Length = 288 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -2 Query: 115 VYYTSYGGGAISLKHGEITVPTPKKDEVLIKTEAVSIN 2 V+Y YGGGA LKH EI +P P KDEVLIK EAVS+N Sbjct: 9 VWYEGYGGGAAKLKHVEIPIPKPSKDEVLIKFEAVSLN 46 >ref|XP_002531075.1| conserved hypothetical protein [Ricinus communis] gi|223529321|gb|EEF31289.1| conserved hypothetical protein [Ricinus communis] Length = 109 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -2 Query: 115 VYYTSYGGGAISLKHGEITVPTPKKDEVLIKTEAVSIN 2 V Y YGGGA LKH E+ VP+PKKDE+L+K EA SIN Sbjct: 9 VQYDKYGGGAAGLKHVEVPVPSPKKDEILLKLEATSIN 46