BLASTX nr result
ID: Angelica23_contig00046795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00046795 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631743.1| PREDICTED: receptor-like protein 12-like [Vi... 57 2e-06 emb|CBI34017.3| unnamed protein product [Vitis vinifera] 55 6e-06 >ref|XP_003631743.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Length = 1067 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/51 (52%), Positives = 33/51 (64%), Gaps = 6/51 (11%) Frame = -1 Query: 138 LSDKLVHSFQCCA------LGDNLLEDTFPFWMGTLPQLQVLVLHANRFWG 4 L K+ S C LGDN + DTFPFW+G LPQLQVLVL +N+F+G Sbjct: 746 LEGKVPRSLSTCKGLEVLDLGDNQIHDTFPFWLGNLPQLQVLVLRSNKFYG 796 >emb|CBI34017.3| unnamed protein product [Vitis vinifera] Length = 849 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/52 (51%), Positives = 33/52 (63%), Gaps = 6/52 (11%) Frame = -1 Query: 138 LSDKLVHSFQCCA------LGDNLLEDTFPFWMGTLPQLQVLVLHANRFWGS 1 L K+ S C LGDN + DTFPFW+G LPQLQVLVL +N+F+ S Sbjct: 582 LEGKVPRSLSTCKGLEVLDLGDNQIHDTFPFWLGNLPQLQVLVLRSNKFYVS 633