BLASTX nr result
ID: Angelica23_contig00046763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00046763 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275581.2| PREDICTED: pentatricopeptide repeat-containi... 102 3e-20 emb|CBI21289.3| unnamed protein product [Vitis vinifera] 102 3e-20 ref|XP_002269662.2| PREDICTED: putative pentatricopeptide repeat... 102 3e-20 ref|XP_002964105.1| hypothetical protein SELMODRAFT_82024 [Selag... 102 3e-20 ref|XP_002992065.1| hypothetical protein SELMODRAFT_134581 [Sela... 102 3e-20 >ref|XP_002275581.2| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Vitis vinifera] Length = 735 Score = 102 bits (255), Expect = 3e-20 Identities = 43/56 (76%), Positives = 49/56 (87%) Frame = -2 Query: 345 TSPGTTLRVTKNLRICGDCHTAIKFISKLYGREIVVRDVSRFHNFKDGLCSCGDYW 178 T PGTT+ + KNLR+CGDCHTAIKFISK+ REIVVRD RFH+F+DGLCSCGDYW Sbjct: 680 TVPGTTIHIIKNLRVCGDCHTAIKFISKIVDREIVVRDSKRFHHFRDGLCSCGDYW 735 >emb|CBI21289.3| unnamed protein product [Vitis vinifera] Length = 581 Score = 102 bits (255), Expect = 3e-20 Identities = 43/56 (76%), Positives = 49/56 (87%) Frame = -2 Query: 345 TSPGTTLRVTKNLRICGDCHTAIKFISKLYGREIVVRDVSRFHNFKDGLCSCGDYW 178 T PGTT+ + KNLR+CGDCHTAIKFISK+ REIVVRD RFH+F+DGLCSCGDYW Sbjct: 526 TVPGTTIHIIKNLRVCGDCHTAIKFISKIVDREIVVRDSKRFHHFRDGLCSCGDYW 581 >ref|XP_002269662.2| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142-like [Vitis vinifera] Length = 689 Score = 102 bits (254), Expect = 3e-20 Identities = 44/56 (78%), Positives = 48/56 (85%) Frame = -2 Query: 345 TSPGTTLRVTKNLRICGDCHTAIKFISKLYGREIVVRDVSRFHNFKDGLCSCGDYW 178 T PG LRVTKNLRICGDCH A KFISK+Y REI+VRD++RFH FKDG CSCGDYW Sbjct: 634 TRPGVVLRVTKNLRICGDCHAATKFISKIYEREIIVRDLNRFHCFKDGSCSCGDYW 689 >ref|XP_002964105.1| hypothetical protein SELMODRAFT_82024 [Selaginella moellendorffii] gi|300167834|gb|EFJ34438.1| hypothetical protein SELMODRAFT_82024 [Selaginella moellendorffii] Length = 713 Score = 102 bits (254), Expect = 3e-20 Identities = 42/56 (75%), Positives = 49/56 (87%) Frame = -2 Query: 345 TSPGTTLRVTKNLRICGDCHTAIKFISKLYGREIVVRDVSRFHNFKDGLCSCGDYW 178 T PGTTLRV KNLR+C DCH A KFIS++ GR+I+VRD SRFH+FKDG+CSCGDYW Sbjct: 658 TPPGTTLRVVKNLRVCSDCHAATKFISQIVGRQIIVRDTSRFHHFKDGVCSCGDYW 713 >ref|XP_002992065.1| hypothetical protein SELMODRAFT_134581 [Selaginella moellendorffii] gi|300140187|gb|EFJ06914.1| hypothetical protein SELMODRAFT_134581 [Selaginella moellendorffii] Length = 771 Score = 102 bits (254), Expect = 3e-20 Identities = 42/56 (75%), Positives = 49/56 (87%) Frame = -2 Query: 345 TSPGTTLRVTKNLRICGDCHTAIKFISKLYGREIVVRDVSRFHNFKDGLCSCGDYW 178 T PGTTLRV KNLR+C DCH A KFIS++ GR+I+VRD SRFH+FKDG+CSCGDYW Sbjct: 716 TPPGTTLRVVKNLRVCSDCHAATKFISQIVGRQIIVRDTSRFHHFKDGVCSCGDYW 771