BLASTX nr result
ID: Angelica23_contig00046593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00046593 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_199043.1| cysteine/histidine-rich C1 domain-containing pr... 60 1e-07 dbj|BAB10201.1| unnamed protein product [Arabidopsis thaliana] 60 1e-07 ref|XP_004154909.1| PREDICTED: uncharacterized protein LOC101231... 60 2e-07 ref|XP_004147878.1| PREDICTED: uncharacterized protein LOC101206... 60 2e-07 ref|NP_179556.1| cysteine/histidine-rich C1 domain-containing pr... 59 4e-07 >ref|NP_199043.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|332007408|gb|AED94791.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 694 Score = 60.5 bits (145), Expect = 1e-07 Identities = 22/65 (33%), Positives = 38/65 (58%) Frame = +2 Query: 8 IRCMLKPHRVNHRWDPHPLYLILFPKDVADHPHEYECEFCSEQIDTNRWFYHCSVCDLSF 187 IRC P + ++++D HPL L +D +Y CE C ++D ++WFY C C ++ Sbjct: 555 IRCATLPTKAHYKYDRHPLTLCYGDEDTTSG--QYWCEICESKLDASKWFYTCEFCSITL 612 Query: 188 HIDCI 202 H++C+ Sbjct: 613 HVNCL 617 >dbj|BAB10201.1| unnamed protein product [Arabidopsis thaliana] Length = 694 Score = 60.5 bits (145), Expect = 1e-07 Identities = 22/65 (33%), Positives = 38/65 (58%) Frame = +2 Query: 8 IRCMLKPHRVNHRWDPHPLYLILFPKDVADHPHEYECEFCSEQIDTNRWFYHCSVCDLSF 187 IRC P + ++++D HPL L +D +Y CE C ++D ++WFY C C ++ Sbjct: 555 IRCATLPTKAHYKYDRHPLTLCYGDEDTTSG--QYWCEICESKLDASKWFYTCEFCSITL 612 Query: 188 HIDCI 202 H++C+ Sbjct: 613 HVNCL 617 >ref|XP_004154909.1| PREDICTED: uncharacterized protein LOC101231870 [Cucumis sativus] Length = 430 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/62 (41%), Positives = 34/62 (54%) Frame = +2 Query: 14 CMLKPHRVNHRWDPHPLYLILFPKDVADHPHEYECEFCSEQIDTNRWFYHCSVCDLSFHI 193 C P V +R+DPHPL L F + + EY CE C E+ D WFY C C+ + H+ Sbjct: 128 CATLPLGVRYRFDPHPLDLTFFENEEEE---EYCCEICEEKRDPGPWFYGCQKCNFAAHL 184 Query: 194 DC 199 DC Sbjct: 185 DC 186 >ref|XP_004147878.1| PREDICTED: uncharacterized protein LOC101206314 [Cucumis sativus] Length = 829 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/62 (41%), Positives = 34/62 (54%) Frame = +2 Query: 14 CMLKPHRVNHRWDPHPLYLILFPKDVADHPHEYECEFCSEQIDTNRWFYHCSVCDLSFHI 193 C P V +R+DPHPL L F + + EY CE C E+ D WFY C C+ + H+ Sbjct: 527 CATLPLGVRYRFDPHPLDLTFFENEEEE---EYCCEICEEKRDPGPWFYGCQKCNFAAHL 583 Query: 194 DC 199 DC Sbjct: 584 DC 585 >ref|NP_179556.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|44917427|gb|AAS49038.1| At2g19660 [Arabidopsis thaliana] gi|330251815|gb|AEC06909.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 662 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +2 Query: 2 MHIRCMLKPHRVN-HRWDPHPLYLILFPKDVADHPHEYECEFCSEQIDTNRWFYHCSVCD 178 + +C L P +V HR+D HPLYL V EY CE C ++++ +WFY C+ C Sbjct: 522 LDFKCALLPQKVKWHRYDDHPLYLSCGESSVDG---EYWCEACETKVNSKKWFYTCNDCG 578 Query: 179 LSFHIDCI 202 + HI C+ Sbjct: 579 VILHISCV 586