BLASTX nr result
ID: Angelica23_contig00046492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00046492 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containi... 71 8e-11 >ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Vitis vinifera] gi|296086664|emb|CBI32299.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 71.2 bits (173), Expect = 8e-11 Identities = 37/71 (52%), Positives = 51/71 (71%) Frame = -1 Query: 223 GLFANRWSNADIQAKQELVHKVSVLRDELIRVSKNGQNEIFRVLDEKGRCLFRGNANGDA 44 GLF+++ S D++A++EL KVS LRDEL+ S + + + RVL+EKG LFR +NG A Sbjct: 45 GLFSDKHSELDLRAREELRGKVSQLRDELVP-SGDDSDMVVRVLEEKGESLFRSYSNGSA 103 Query: 43 FVELVKQLEPW 11 FVEL+KQL W Sbjct: 104 FVELLKQLSSW 114